SNX7 (sorting nexin 7)

Gene

• Entrez ID: 51375
• Gene name: Sorting nexin 7
• Gene symbol: SNX7
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1p21.3
• Summary: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like s

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021387	hsa-miR-9-5p	Microarray	17612493
MIRT021836	hsa-miR-132-3p	Microarray	17612493
MIRT022637	hsa-miR-124-3p	Microarray	18668037
MIRT048715	hsa-miR-96-5p	CLASH	23622248
MIRT043181	hsa-miR-324-5p	CLASH	23622248
MIRT1378319	hsa-miR-3622b-5p	CLIP-seq
MIRT1378320	hsa-miR-3662	CLIP-seq
MIRT2335809	hsa-miR-4436b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000423	Process	Mitophagy	IBA
GO:0005515	Function	Protein binding	IPI	16189514, 23085988, 25416956, 28514442, 32296183, 32513819, 33961781, 35271311
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	32513819
GO:0008289	Function	Lipid binding	IEA
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IEA
GO:0015031	Process	Protein transport	IMP	32513819
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0032456	Process	Endocytic recycling	IBA
GO:0034727	Process	Piecemeal microautophagy of the nucleus	IBA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0061709	Process	Reticulophagy	IBA
GO:2000786	Process	Positive regulation of autophagosome assembly	IMP	32513819

Other IDs

• MIM: 614904
• HGNC: 14971
• e!Ensembl: ENSG00000162627

Protein

• UniProt ID: Q9UNH6
• Protein name: Sorting nexin-7
• Protein function: Involved in the regulation of endocytosis and in several stages of intracellular trafficking (PubMed:32513819). Together with SNX4, involved in autophagosome assembly by regulating trafficking and recycling of phospholipid scramblase ATG9A (PubM
• PDB: 3IQ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00787	PX	60 → 147	PX domain	Domain

• Sequence:

  MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSR
  GEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKA
  LHKFLNRIADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVK
  NRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEEDLVD
  TLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVE
  VLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEENIHYY
  EQCLATWESFLTSQTNLHLEEASEDKP

• Sequence length: 387

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26666201	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	26666201	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	27245499		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37743471	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28736931		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27245499		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27245499		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	26666201	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27245499		★☆☆☆☆ Found in Text Mining only