FZR1 (fizzy and cell division cycle 20 related 1)

Gene

• Entrez ID: 51343
• Gene name: Fizzy and cell division cycle 20 related 1
• Gene symbol: FZR1
• Synonyms (NCBI Gene): CDC20C, CDH1, DEE109, FZR, FZR2, HCDH, HCDH1
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037711	hsa-miR-744-5p	CLASH	23622248
MIRT708951	hsa-miR-3714	HITS-CLIP	19536157
MIRT708950	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT708949	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT708948	hsa-miR-940	HITS-CLIP	19536157
MIRT708947	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT708946	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT708944	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT708943	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT708942	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT708951	hsa-miR-3714	HITS-CLIP	19536157
MIRT708950	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT708949	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT708948	hsa-miR-940	HITS-CLIP	19536157
MIRT708947	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT708946	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT708945	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT708944	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT708943	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT708942	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT573199	hsa-miR-4310	PAR-CLIP	20371350
MIRT573198	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT573197	hsa-miR-4328	PAR-CLIP	20371350
MIRT573196	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT573195	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573193	hsa-miR-4711-5p	PAR-CLIP	20371350
MIRT573194	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT708951	hsa-miR-3714	HITS-CLIP	19536157
MIRT708950	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT708949	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT708948	hsa-miR-940	HITS-CLIP	19536157
MIRT708947	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT708946	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT708944	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT708943	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT708942	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT708951	hsa-miR-3714	HITS-CLIP	19536157
MIRT708950	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT708949	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT708948	hsa-miR-940	HITS-CLIP	19536157
MIRT708947	hsa-miR-296-3p	HITS-CLIP	19536157
MIRT708946	hsa-miR-6823-5p	HITS-CLIP	19536157
MIRT708945	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT708944	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT708943	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT708942	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT573199	hsa-miR-4310	PAR-CLIP	20371350
MIRT573198	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT573197	hsa-miR-4328	PAR-CLIP	20371350
MIRT573196	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT573195	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573193	hsa-miR-4711-5p	PAR-CLIP	20371350
MIRT573194	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT1008591	hsa-miR-2277-3p	CLIP-seq
MIRT1008592	hsa-miR-2467-3p	CLIP-seq
MIRT1008593	hsa-miR-3184	CLIP-seq
MIRT1008594	hsa-miR-34a	CLIP-seq
MIRT1008595	hsa-miR-361-3p	CLIP-seq
MIRT1008596	hsa-miR-423-5p	CLIP-seq
MIRT1008597	hsa-miR-4257	CLIP-seq
MIRT1008598	hsa-miR-4447	CLIP-seq
MIRT1008599	hsa-miR-4472	CLIP-seq
MIRT1008600	hsa-miR-449b	CLIP-seq
MIRT1008601	hsa-miR-4519	CLIP-seq
MIRT1008602	hsa-miR-4710	CLIP-seq
MIRT1008603	hsa-miR-486-3p	CLIP-seq
MIRT1008604	hsa-miR-541	CLIP-seq
MIRT1008605	hsa-miR-542-3p	CLIP-seq
MIRT1008606	hsa-miR-548aa	CLIP-seq
MIRT1008607	hsa-miR-665	CLIP-seq
MIRT1008608	hsa-miR-922	CLIP-seq
MIRT1008609	hsa-miR-1273c	CLIP-seq
MIRT1998827	hsa-miR-1265	CLIP-seq
MIRT1998828	hsa-miR-2115	CLIP-seq
MIRT1998829	hsa-miR-217	CLIP-seq
MIRT1998830	hsa-miR-218	CLIP-seq
MIRT1008591	hsa-miR-2277-3p	CLIP-seq
MIRT1998831	hsa-miR-299-3p	CLIP-seq
MIRT1998832	hsa-miR-3147	CLIP-seq
MIRT1998833	hsa-miR-3150a-3p	CLIP-seq
MIRT1998834	hsa-miR-3151	CLIP-seq
MIRT1998835	hsa-miR-3175	CLIP-seq
MIRT1998836	hsa-miR-3180	CLIP-seq
MIRT1998837	hsa-miR-3180-3p	CLIP-seq
MIRT1998838	hsa-miR-3180-5p	CLIP-seq
MIRT1998839	hsa-miR-3183	CLIP-seq
MIRT1998840	hsa-miR-3196	CLIP-seq
MIRT1008594	hsa-miR-34a	CLIP-seq
MIRT1008595	hsa-miR-361-3p	CLIP-seq
MIRT1008597	hsa-miR-4257	CLIP-seq
MIRT1998841	hsa-miR-4268	CLIP-seq
MIRT1998842	hsa-miR-4425	CLIP-seq
MIRT1008598	hsa-miR-4447	CLIP-seq
MIRT1998843	hsa-miR-4448	CLIP-seq
MIRT1008599	hsa-miR-4472	CLIP-seq
MIRT1998844	hsa-miR-4481	CLIP-seq
MIRT1008600	hsa-miR-449b	CLIP-seq
MIRT1998845	hsa-miR-450b-3p	CLIP-seq
MIRT1998846	hsa-miR-4514	CLIP-seq
MIRT1008601	hsa-miR-4519	CLIP-seq
MIRT1998847	hsa-miR-4666-5p	CLIP-seq
MIRT1998848	hsa-miR-4692	CLIP-seq
MIRT1998849	hsa-miR-4707-3p	CLIP-seq
MIRT1998850	hsa-miR-4723-3p	CLIP-seq
MIRT1998851	hsa-miR-4733-3p	CLIP-seq
MIRT1998852	hsa-miR-4745-5p	CLIP-seq
MIRT1998853	hsa-miR-4764-5p	CLIP-seq
MIRT1998854	hsa-miR-4781-3p	CLIP-seq
MIRT1998855	hsa-miR-491-5p	CLIP-seq
MIRT1998856	hsa-miR-516a-3p	CLIP-seq
MIRT1998857	hsa-miR-520a-5p	CLIP-seq
MIRT1998858	hsa-miR-525-5p	CLIP-seq
MIRT1008607	hsa-miR-665	CLIP-seq
MIRT1998859	hsa-miR-766	CLIP-seq
MIRT1998860	hsa-miR-769-3p	CLIP-seq
MIRT1998861	hsa-miR-939	CLIP-seq
MIRT1008593	hsa-miR-3184	CLIP-seq
MIRT1008596	hsa-miR-423-5p	CLIP-seq
MIRT1998849	hsa-miR-4707-3p	CLIP-seq
MIRT2388315	hsa-miR-4726-3p	CLIP-seq
MIRT2388316	hsa-miR-4758-3p	CLIP-seq
MIRT1008607	hsa-miR-665	CLIP-seq
MIRT1008592	hsa-miR-2467-3p	CLIP-seq
MIRT2465339	hsa-miR-3919	CLIP-seq
MIRT1008591	hsa-miR-2277-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10548110, 11459826, 11988738, 16921029, 17719540, 18662541, 20424596, 20802534, 21186364, 21241890, 21596315, 21986944, 22014574, 22632967, 22770219, 23708001, 24163370, 27653696, 31722219, 33961781
GO:0005634	Component	Nucleus	IDA	34788397
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IDA	18662541
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010997	Function	Anaphase-promoting complex binding	IBA
GO:0010997	Function	Anaphase-promoting complex binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	14701726, 18662541, 21596315
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0031965	Component	Nuclear membrane	IDA
GO:0040020	Process	Regulation of meiotic nuclear division	IEA
GO:0046105	Process	Thymidine biosynthetic process	IDA	14697231
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	TAS	21596315
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IEA
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	IDA	11459826
GO:1904860	Process	DNA synthesis involved in mitotic DNA replication	IDA	14697231
GO:1905786	Process	Positive regulation of anaphase-promoting complex-dependent catabolic process	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	14701726
GO:1990757	Function	Ubiquitin ligase activator activity	IBA
GO:2000773	Process	Negative regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	ISS

Other IDs

• MIM: 603619
• HGNC: 24824
• e!Ensembl: ENSG00000105325

Protein

• UniProt ID: Q9UM11
• Protein name: Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1)
• Protein function: Substrate-specific adapter for the anaphase promoting complex/cyclosome (APC/C) E3 ubiquitin-protein ligase complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The A
• PDB: 4UI9, 5L9T, 5L9U, 8TAR, 8TAU, 9GAW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12894	ANAPC4_WD40	210 → 282	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
  PF00400	WD40	303 → 341	WD domain, G-beta repeat	Repeat
  PF00400	WD40	345 → 386	WD domain, G-beta repeat	Repeat
  PF00400	WD40	433 → 471	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed at high levels in heart, liver, spleen and some cancer cell lines whereas isoform 3 is expressed only at low levels in these tissues. {ECO:0000269|PubMed:12797865}.
• Sequence:

  MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVN
  FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
  TPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
  APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
  GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRT
  PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
  IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
  SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
  VKWESVSVLNLFTRIR

• Sequence length: 496

Pathways

KEGG:

Cell cycle
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation

Reactome:

Autodegradation of Cdh1 by Cdh1:APC/C
SCF-beta-TrCP mediated degradation of Emi1
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
Phosphorylation of Emi1
Senescence-Associated Secretory Phenotype (SASP)
CDK-mediated phosphorylation and removal of Cdc6
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional Regulation by VENTX
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental and epileptic encephalopathy 109	Pathogenic	rs2512277062, rs2512277057, rs1002017728	RCV002464996 RCV002464997 RCV002464998 RCV002464999	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autism	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebellar ataxia	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FZR1-related condition	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hypotonia	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	Pubtator	30843342, 39201352	Associate	★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	21595730		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	28143883		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	27374082		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10408414, 10547575, 11753952, 12409641, 15639718, 16596173, 16991125, 18223216, 19748854, 20082476, 20534996, 23838140, 24933634, 29422640		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15660698, 16596173, 16685438, 18197935		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	25908636		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11555590		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	19011631, 31089142		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	21985494		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22272264, 30008585, 31317666		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	30782064		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	12452045, 15943036		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	15044918, 27665273		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	17520682		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17873891		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23029563		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12647217, 14691304, 15042681, 15203750, 15361208, 16259108, 17905526, 18632876, 18662704, 19900189, 20572039, 21134075, 23504555		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	12647217, 16949915, 17905526		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15796198		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	15029256, 17206475, 31346954		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	27665273		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	31452946	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26621834	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	23303021, 28390135, 29850393, 32985799	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25690860	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	27069257	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	19826416, 23315031		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942, 17520682, 8075649		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	29365031	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30726108		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	18683894	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31177911		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	29952716	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	11937138	Stimulate	★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	27665273		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17076892	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33145365, 35904110	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17548604	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18418437		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21540309, 24054361		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334, 18551395	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18551395, 21127944		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	35782055	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18703780		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18703780, 34329656	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30890477		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21459793, 30706537, 30747219		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17405999, 22583970, 23382633, 7819034	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27191723, 30268789		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	9422531	Inhibit	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24204729	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	18551395		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21694441, 31276688		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	25329121	Stimulate	★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	35478157	Inhibit	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	38243303	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	19420730	Inhibit	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30906331	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	12107841, 15471559, 19184677, 27941621	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10891567, 11549575, 12203370, 16922727, 16934975, 18702824, 24404589, 24491043, 26901067		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11839665, 12203370, 17593336		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	17520682, 26901067		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	22002244		★☆☆☆☆ Found in Text Mining only
Blepharo-cheilo-dontic syndrome	Blepharocheilodontic syndrome	BEFREE	28301459, 29348693		★☆☆☆☆ Found in Text Mining only
Blepharo-cheilo-dontic syndrome	Blepharocheilodontic syndrome	ORPHANET_DG	28301459		★☆☆☆☆ Found in Text Mining only
Blepharo-cheilo-odontic syndrome	Blepharocheilodontic Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
BLEPHAROCHEILODONTIC SYNDROME 1	Blepharocheilodontic Syndrome	GENOMICS_ENGLAND_DG	27566442		★☆☆☆☆ Found in Text Mining only
BLEPHAROCHEILODONTIC SYNDROME 1	Blepharocheilodontic Syndrome	UNIPROT_DG	28301459		★☆☆☆☆ Found in Text Mining only
BLEPHAROCHEILODONTIC SYNDROME 1	Blepharocheilodontic Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	18200054	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	35646332	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	35646332	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	12049819		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17905526, 18720359, 21196339, 29287594, 36435874	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24933634	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	CLINGEN_DG	10074450, 17097565, 17660459, 2007622, 21271559, 22850631, 23053649, 23709761, 24366306, 24733792, 26182300, 7961105		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	29522266		★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	10394882, 10584868, 11562785, 11597316, 11857408, 12800196, 16061854, 16527687, 17522512, 17545690, 17660459, 18684065, 18798546, 19191266, 19294736, 20921021, 20942901, 22020549, 22326525, 22846738, 23575477, 23709761, 24493355, 25777964, 25979631, 26759166, 27441520, 29348693, 29929997, 30007404, 30066183, 30311375, 30745422, 30935944, 31273560, 31467357		★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10433926, 10477433, 10969774, 11161777, 11196175, 11729114, 11857408, 11912130, 11948460, 12163387, 12409641, 14534701, 15135482, 16116478, 16512896, 17660459, 1793731, 18213475, 18418215, 18544963, 18701415, 19763817, 19834798, 19893985, 19957299, 20568901, 20716965, 20921021, 21613543, 21681822, 22026417, 22297548, 22876288, 23276794, 23551055, 23601657, 23709761, 24292671, 24528085, 24618085, 25039920, 25124632, 25591616, 25758127, 25979631, 26182300, 26285011, 26425077, 26566278, 26666818, 26674224, 26694515, 26825466, 27174021, 27349965, 27500741, 27811364, 27852262, 27930738, 28135249, 28867731, 28979331, 29050223, 29285016, 29287594, 29348693, 29433565, 29732000, 30008850, 30616060, 30862505, 30954555, 31206626, 31420536, 8557030, 9463572, 9581841		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17520682, 19839049, 23921149, 24014025		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10433926, 10584868, 11305955, 11322170, 11705887, 11976333, 12163387, 12439718, 14580257, 15161659, 15235021, 15330167, 15459769, 15742334, 16025112, 16033070, 16280054, 16373333, 16473926, 16495925, 16512896, 16821070, 16932944, 16980628, 17143261, 17244359, 17522512, 17611401, 17649807, 17660459, 17997862, 17998253, 18062917, 18221536, 18225549, 18271926, 18381931, 18434311, 18442100, 18485221, 18554584, 18798546, 19048123, 19050801, 19240236, 19242056, 19256762, 19257890, 19383788, 19515834, 19603142, 19657672, 19789364, 19799609, 19834798, 20010940, 20086175, 20356845, 20490964, 20507565, 20591882, 20609236, 20716965, 20921021, 21047437, 21063415, 21168302, 21271559, 21281808, 21347235, 21356067, 21383541, 21681822, 21724833, 21837480, 21883696, 21916701, 21964676, 22026417, 22270359, 22297548, 22464177, 22562246, 22847191, 22986510, 23020053, 23133563, 23318438, 23376074, 23399642, 23601657, 23620408, 23637229, 23671646, 23771069, 23949920, 23954296, 23975422, 24023670, 24045665, 24124614, 24228128, 24292867, 24366306, 24376848, 24498881, 24504364, 24508063, 24528085, 24811890, 24884479, 24934762, 25017439, 25031724, 25086032, 25089230, 25123151, 25315069, 25315241, 25342558, 25553984, 25635394, 25674234, 25733818, 25756282, 25879941, 26182300, 26218882, 26285011, 26452468, 26467042, 26666818, 26671626, 26694515, 26702618, 26842184, 26853861, 26906973, 26996066, 27053345, 27255086, 27323810, 27329104, 27485598, 27811364, 27852262, 27925203, 27930738, 28011157, 28027327, 28212558, 28407996, 28418444, 28419251, 28476646, 28739725, 28766847, 28779344, 28852133, 28867731, 28891274, 28901319, 29032073, 29115551, 29203642, 29287594, 29368542, 29433565, 29522266, 29559730, 29742177, 29758926, 29798843, 30054569, 30066183, 30257646, 30305115, 30318965, 30423024, 30570852, 30710426, 30744493, 30770770, 30841634, 30862505, 30883028, 30954555, 31104011, 31206626, 31273560, 31424658, 31467357, 31486498, 31511359, 31533668, 31568637, 31578396, 31760501, 31801599, 31871109, 31963833, 32125938, 32260281, 32300922, 32318955, 32426802, 32432750, 32572153, 32573871, 32599083, 32886433, 32997132, 33148662, 33280520, 33303690, 33471974, 33549054, 33560870, 33617508, 33619332, 33716295, 33770698, 33826040, 33827469, 33886068, 33899544, 33971623, 34096887, 34217266, 34257600, 34264524, 34299313, 34364397, 34487234, 34510244, 34636027, 34643667, 34672684, 34715746, 34866136, 34888385, 34889530, 34916361, 34932597, 34949788, 34977446, 35030975, 35323371, 35348275, 35448173, 35639459, 35784532, 35915218, 36087100, 36329030, 36360219, 36422008, 36436516, 36553480, 36562524, 36600593, 36709040, 36757813, 36774386, 36805828, 36910346, 36913304, 36990610, 37202799, 37239898, 37454130, 37466609, 37925055, 38229073, 39339466, 40305907, 40523834, 40595045, 7682767, 7775259, 7961105, 8347483, 8557030, 8883410, 9405455, 9422525	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10545506, 10644736, 12068329, 15958594, 19893985, 20551954, 20818341, 22012049, 23890049, 25124632, 26150337, 29133484, 30180878, 31880901, 37369698, 40049332, 8256859	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26534844, 36315446	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	9811344	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	20462505		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23475579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12631658, 12695555, 14675348, 15375433, 16428266, 16512896, 16521229, 17047049, 17663505, 18223216, 18703780, 19940363, 20032387, 20520968, 20715154, 21455633, 22069487, 22415887, 23317244, 23504555, 23555086, 23771069, 23840677, 23954158, 24356446, 24516707, 24528029, 24656654, 24838934, 25534230, 25619476, 25879941, 26206264, 26790440, 27412620, 27861150, 27871161, 28121627, 28570699, 28851898, 28871001, 30229897, 30401720, 30760857, 31261642, 31271097, 32035486, 35024730, 35782055, 37707375, 9535896	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	15712207, 22825745, 25413006, 29422640	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10211998, 10547575, 10749913, 11304579, 11313896, 11496321, 12163387, 12210063, 12409641, 12434413, 12588804, 12610504, 14556664, 14630673, 14750169, 14998854, 15361706, 16127748, 16531765, 17327688, 17609302, 18197935, 18223216, 19432899, 20112504, 20418909, 21613543, 22752307, 23849133, 24952891, 24998851, 25019985, 25439071, 26246502, 26901067, 27349965, 27729431, 28455161, 29168119, 30390382, 8033105, 9045944, 9195232, 9387937		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11304579, 17060462, 25315069	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942, 17520682, 8075649		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16982802, 19050793, 25779657, 26125777, 26429873, 26837418, 2774055, 28069049, 28534983, 32487254, 32661742, 9045944	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	15044918, 17520682, 26349748, 28545522, 31452946	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26429176, 27058893, 30089731, 36961748, 8286199	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	7640213	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11305955, 11322170, 12712492, 14580257, 16512896, 17437014, 19751508, 19893985, 22012049, 23188432, 23729783, 25124632, 25645984, 26916073, 28901319, 30760857, 32599083, 39256827	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	7534041, 8256859, 8883410	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17244359, 19242056, 19789364, 23188432, 30359996, 8183909	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	22012049, 30760857, 8256859	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16461565, 23743934	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	18607832, 19215686, 28174789, 28937296, 29237910	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12937151, 14507645, 15831995, 16474379, 16534869, 17000670, 18691339, 18837082, 19140237, 19818350, 20044617, 20331628, 21060828, 21323792, 21345006, 21494073, 21625435, 21706058, 22180715, 22488108, 22799330, 22949882, 23391410, 23464474, 23468978, 23483955, 23870199, 23936798, 24059685, 24091674, 24136747, 24304617, 24313979, 24614035, 24675684, 24795530, 24840636, 24890815, 24966965, 25387077, 25753478, 26165819, 26404322, 26498355, 26655845, 26944057, 27298373, 27420998, 27611941, 27755964, 28276928, 28521610, 28771223, 29042578, 29295626, 29295731, 29735783, 29862272, 30180906, 30265210, 30272278, 30915743, 31969493, 32146796, 32239101, 32280692, 32740091, 32829570, 32904434, 33015774, 33179108, 33215860, 33260674, 33336733, 33420124, 33422101, 33642822, 33902004, 34443536, 35024730, 35080329, 35108614, 35143426, 35260047, 35345355, 35900486, 36010583, 36613521, 36675278, 37486695, 37499450, 39207047, 39522317, 39587816, 40507937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19465902, 30453302	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24386414	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	11322170, 15871722, 16033070, 17649807, 23724131, 23837653, 27461702, 27837621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	12216092, 15685613, 16505783	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	10897329, 11322170, 14645693, 17244359, 18769130, 21375733, 23062488, 24966968, 27247112, 29344954, 35587107	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	15712207	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	12712492, 16512896, 22864775, 30228172, 40645971, 8256859, 9422525	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	15161659, 15354217, 15696125, 17239264, 26451490, 26643573, 26729235, 27078887, 27811364, 30414230, 31018945, 32599083, 32661241, 35922548, 36332363, 37925055, 39201647, 40049332, 40356444, 8557030, 8883410, 9365159	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	23782331	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	10923074, 19396152, 22814318	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	15999364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10891567, 11549575, 12203370, 16922727, 16934975, 18702824, 24404589, 24491043, 26901067		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12579297, 24831064, 27689323		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15814621, 16598757, 17960794, 19118009, 19738073, 22799366, 22818553, 23244126, 23706417, 24838315, 24906605, 24933634, 25810011, 25931811, 30127990, 30390382, 31207149		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16461565, 17653889, 22543706, 23605324, 24499657, 25230372, 26191276, 26757261, 26887977, 27044634, 29996940, 30324802, 30846486, 31158220, 31653136, 36814597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20160041, 21552209, 21992816, 24048788, 25799022, 28475017, 29273724, 29374219, 31177911, 33762591, 35455997, 37246239, 39682758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20529828, 29924959	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11551917, 14657952, 15685621, 17607380, 18195710, 18327819, 19551141, 20074327, 20514858, 21808237, 22363672, 23658743, 26152359, 27619681, 28223537, 28742884, 29607933, 30824757, 31322246, 31486486, 31672157, 31692936, 31702026, 31915310, 32633350, 33215419, 33237989, 35414767, 37344930, 37584255, 7841055	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17060462, 19215686, 30816490, 34825321	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25413006, 39682758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11900566, 15466396, 16199889, 18264727, 18671846, 20498638, 21507233, 21986963, 22207358, 22692503, 23826417, 23999979, 24758269, 25380749, 25695541, 26617850, 26790440, 27138192, 27223886, 28099920, 28604655, 29637533, 30452490, 30484070, 31222140, 31658318, 32640423, 32727513, 33274608, 36012449, 8978829, 9166940	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17071808, 19270647, 21849853, 22850983, 29470526, 34666560, 36308176	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	16799706, 19849847, 22903481	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	18295959		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14970867, 16826427, 18035404, 19486012, 23572389, 23605324, 27067410, 27779545, 28934230, 29113366, 29113377, 29932878, 30324802, 31653136		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	29273724		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942, 17520682, 8075649		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19389926	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	18662704, 23062488, 9365159		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	28442786, 33274006	Inhibit	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	28854563	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Germinoma	Central Nervous System Germinoma	BEFREE	18158575		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	17905526		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14750164, 17894941, 29085462, 29237293		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28599442		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14750164, 17894941, 20112504, 29085462, 29237293		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	24054361		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	15029256, 17206475, 31346954		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12213730, 15467712, 16311342, 17550320, 18691339, 22068819, 22664794, 23688168, 24272200, 24816558, 24867095, 25077440, 25391422, 30248044, 32020235, 35022330, 38212892	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	18234642		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18595142, 23480772	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	19420730	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	26888362	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	11729215, 26888362, 29360338	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19745069, 23432814, 30601084		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21047437	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	9139867		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	35647835	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	15831593, 18683894, 24793288, 24838934, 32260281, 32886433	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	15831593, 20880515, 24838934, 28151848		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	12068329, 15831593, 24838934, 28151848, 28376813, 31419083, 39596675	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	36468602	Stimulate	★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29218001		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	10694944	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	24531714	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19915572, 21830274, 25303049, 32775420	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11535849, 16203744, 16283382, 19802011, 23900215, 23900729, 26819089, 30594943		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11451996, 11470825, 17557293, 19253033, 19302290, 21625458, 23121893, 24284071, 25908636, 26619103, 31658326, 33770698, 36318684, 37189027	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12517779, 17224907		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27513421	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	9176391	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal cancer, hereditary nonpolyposis, type 1	Colorectal Cancer	CLINGEN_DG	10051639, 10072428, 11968083, 17221870, 26742007, 9537325		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10051639, 10072428, 11171827, 11729114, 11751682, 11896626, 12203775, 12647217, 12824891, 15231691, 15526363, 17342324, 17960397, 18196581, 18503162, 18584348, 19011631, 19569232, 19634113, 19908344, 19915572, 20571967, 21319274, 21455633, 21985494, 21997289, 22286765, 22339265, 22367214, 22684815, 23029563, 24530606, 24684676, 24726916, 24753543, 25146682, 26167814, 26742007, 27259261, 28554075, 28871001, 29283329, 30730459, 30745422, 30880750, 31625007, 31734605, 9203946		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	10072428, 19011631		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	19011631, 31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	19011631		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	10072428, 19011631		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10362114, 12610504, 18503162, 20571967, 23029563, 25738332, 28759954	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10601549, 10638989, 10694944, 10817509, 10896919, 11035789, 11171827, 11850584, 12824891, 12854171, 15122305, 15154912, 15570051, 15802015, 16369045, 16865770, 16948518, 18320073, 18683894, 19290007, 19302290, 19634113, 19908344, 19915572, 20046424, 20132886, 20501757, 20648012, 20844743, 21071512, 21071539, 21119214, 21314996, 21528083, 21531788, 21574102, 21678109, 21747928, 21878201, 21975680, 22012768, 22130667, 22205702, 22278155, 22363440, 22367214, 22690072, 22879968, 22880157, 22999960, 23174018, 23522088, 23737956, 23783026, 23900215, 23996472, 24415879, 24504363, 24720439, 24753543, 24875374, 25117932, 25146682, 25192188, 25197077, 25431258, 25528769, 25532000, 25619476, 25769449, 25890609, 25908636, 25962181, 26097606, 26167814, 26219897, 26363785, 26379394, 26507436, 26619103, 26662312, 26742007, 26830472, 27121310, 27151709, 27254743, 27509205, 27566658, 27608893, 27696107, 27742576, 27902968, 28199979, 28345456, 28548936, 28552992, 28796798, 29138007, 29202800, 29338703, 29352232, 29512788, 29749530, 29863249, 30050103, 30097457, 30135139, 30338799, 30365116, 30401720, 30402843, 30572883, 30664186, 30730459, 30892955, 31173256, 31233902, 31364113, 31505062, 31640089, 31804558, 32141497, 32239671, 32260268, 32373955, 33057364, 33115416, 33237836, 33817713, 34200314, 34214117, 34890102, 34916361, 34949788, 35419458, 35443865, 35645356, 35647190, 35698180, 36062412, 36135759, 36217128, 36258646, 36281556, 36420658, 36465266, 36834820, 37157810, 37986009, 38159250, 38376276, 39206995, 39871234, 7682766, 7880746, 8353041, 9203946, 9484818	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12203775, 12647217, 12824891, 14767510, 15231691, 15289833, 15809746, 16368435, 16865770, 16948518, 17611682, 17960397, 18503162, 18584348, 19082443		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12684753, 30880750		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	19011631, 31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27488539	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	10694944, 24415879, 31207149	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24508461		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24867095, 31812439		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1B	Congenital disorder of glycosylation	Pubtator	24318287	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital euryblepharon	Congenital Euryblepharon	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11568972, 15203750, 18195710, 19641369, 28802251, 31186699		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36538237	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28487953	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19398441		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22152681, 30206406, 32775420, 8774128	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	7745114	Inhibit	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	GWASCAT_DG	26237428		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	1375758	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	18082196	Associate	★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	22277942	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28587416		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	18256147	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	34678092	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29273724		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27411924, 27643646, 29273724	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29273724		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37246239	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22629296, 34737094	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	19050793, 25518919, 32102518, 36308176, 39849873	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17852707, 21459793		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	15330167		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11857408, 12409641, 12973049, 8567396, 9463572		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	18379416		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	29295717		★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	26391562, 30843342	Associate	★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	12635138, 24068440		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	11676834, 18200054	Inhibit	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	LHGDN	18200054		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	20574529, 26683836	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	18551395		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	25306249	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	36332363	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	24373500		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12569599, 12635138, 12896902, 19900189, 20874004, 21940036, 22343305, 23290742, 23743934, 24068440, 24998851, 25892250, 26963853, 28280730, 30405831		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	8075649		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	25282623	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11027430, 11966474, 12497652, 12569599, 15361208, 15736420, 16803534, 18607832, 19215686, 19900189, 21851624, 22569286, 23114646, 23743934, 25282623, 27223076, 27449470, 27643646, 27829043, 28174789, 28280730, 28440489, 28618953, 29080395, 30702562, 31136293, 31864232, 32323819, 37335710, 8188077	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15328195		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19604315, 26367784, 28272224, 31233772	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	24998851		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	8075649		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	27023436		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11966474, 29860279, 33218351, 34794738, 9033262	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12587534, 17660246, 19137776		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17660246, 22434855, 26198055, 26484421, 27023436, 29503661		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22344732, 23899551, 25150394, 26198055, 26484421, 28303918, 29630856, 30702562, 31233772, 32439908, 33249961, 33817715, 35303800, 36233009, 37047609, 37371583, 37867352, 8293849, 9022601	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	36371157	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	28712126, 35239721	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30211842	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	25409297	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31318984, 31441503		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	31318984, 34788397	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16826427, 18035404, 23605324, 27779545, 29932878, 30324802, 31653136		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	29729076		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15355896, 18751390, 20412959, 21373750, 26264242		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17062664		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17348438, 19222093, 19448414, 20412959, 22069487, 25400779, 26898709, 27513557, 27600761, 27832663, 31186031, 32035486, 32432570, 32925786, 33742771, 36475339	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18751390, 20412959, 21373750, 26264242		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12532436, 17047049, 29866946, 32925786	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15484291, 17255337, 17273727, 18084253, 18219111, 19222093, 19432901, 19448414, 19448425, 20025748, 20193117, 21148309, 21150312, 25375090, 26617724, 28556501, 29351209, 29552776, 30880778, 32042337, 32323849, 33403789, 33909822, 35457185, 35578166, 36085568, 9301546	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Stenosis	Esophageal stenosis	Pubtator	21333186	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	22069487	Associate	★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11705864, 16372334, 18781193		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	20922573		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	25927356		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	25927356		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	30008850		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20651370, 26880767		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	21060828		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28608272		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	11683173, 12532418, 17341890		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	16309224, 18158568, 25004291	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36656209	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	8797891		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	17852707		★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	17609302		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14507661, 16428266, 20520968	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17509026, 17760721, 25563818		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	17509026, 17760721		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	24528029	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	24204729	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	24528029	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29042646		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	10896919, 35705314	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19217217, 23786773, 31749661		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	18158575		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	14675328	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	16276119		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	16276119		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23482671, 25359730, 33059753, 33763472, 36453704	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30475349, 31036696		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30475349, 31036696		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21127944, 22544614, 30015885		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27589728, 28349823, 29039584, 30015885, 31906574, 32365279, 32521911, 34104086, 34520391, 37818686	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	30451796	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen storage disease	Pubtator	36613675	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	25890609	Inhibit	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	26152359	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35846879	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35871446	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17284367, 25161999		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	15666322, 19192641, 20443891, 21764905, 21939503, 34768995	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34868339	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10807790		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10807790	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23771069, 39207047	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27298373	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	25695679		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	25695679	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19256762, 21356067, 21764905, 23620408, 24023670, 24127122, 24549055, 29700408, 30623411, 32541686, 36307613, 37563628, 39684258, 9365159	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27956696	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	28993866		★☆☆☆☆ Found in Text Mining only
Hereditary breast cancer	Hereditary Breast Cancer	Orphanet			★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CLINVAR_DG	10037790, 10072428, 10094558, 10433926, 10477433, 10973239, 11104024, 11419427, 11665720, 11968084, 12647996, 12800196, 15138207, 15235021, 15780560, 15831593, 16061854, 16527687, 16924464, 16997156, 17221870, 17261850, 17522512, 17545690, 17660459, 17955726, 18046629, 18391748, 18427545, 18442100, 18726070, 18788075, 19268661, 19269290, 19725995, 19965908, 20066110, 20233471, 20371349, 20373070, 20624523, 20719348, 20824432, 21271559, 21424370, 21681551, 21696387, 22020549, 22098830, 22118538, 22225527, 22723466, 22850631, 23124477, 2317870, 23264079, 23575477, 23709761, 23752020, 24366306, 24389957, 24424122, 24493355, 24763289, 25123297, 25186627, 25315765, 25525159, 25741868, 26022348, 26025002, 26072394, 26182300, 26270727, 26681312, 26845104, 27064202, 27153395, 27192129, 27512640, 27582386, 27682646, 27730413, 27880784, 27995193, 28195815, 28202063, 28688938, 28873162, 29156750, 29511593, 29577179, 29769627, 29798843, 30264118, 30745422, 8127895, 9537325, 9751616		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	BEFREE	10072428, 10389930, 10477433, 10593993, 10973239, 11419427, 11602891, 11729114, 11968083, 11968084, 12145417, 12191636, 12588804, 12604719, 12690477, 12908778, 14630673, 14661064, 15138207, 15141383, 15231691, 15235021, 15288293, 15313375, 15368100, 15475432, 15735979, 15753528, 15780560, 15831593, 15895459, 16061854, 16527687, 16555931, 16571431, 16600987, 16787116, 16801346, 16870389, 16924464, 16997157, 17126523, 17221870, 17434710, 17513507, 17522512, 17545690, 17660459, 17690113, 18046629, 18185018, 18391748, 18427545, 18442100, 18672140, 18684065, 18788075, 18825658, 19168852, 19223545, 19247957, 19269290, 19408054, 19432899, 19474748, 19965908, 20373070, 20471195, 20534996, 20591882, 20624523, 20719348, 20842455, 20921021, 21106365, 21134075, 21184285, 21424370, 21681551, 21696387, 21777349, 21872467, 22020549, 22160243, 22326525, 22388873, 22543498, 22738705, 22850631, 23071139, 23264079, 23481202, 23555086, 23639640, 23752020, 24037103, 24240619, 24366306, 24389957, 24424140, 24472763, 24493355, 25187893, 25340522, 25388006, 25576241, 25638682, 25771876, 25979631, 25981591, 26072394, 26182300, 26363540, 26759166, 27256430, 27441520, 27573781, 27582386, 27752808, 27880784, 27899187, 28024868, 28204904, 28301459, 28455161, 28460635, 28476807, 28688938, 28789394, 29131691, 29231860, 29307626, 29341148, 29348693, 29376063, 29589180, 29706558, 29769627, 30007404, 30014492, 30066183, 30068367, 30145018, 30306390, 30311375, 30466290, 30542785, 30568591, 30745422, 31109593, 31220641, 31246251, 31467357		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	10072428, 12588804, 19168852, 19184424, 24816253, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CLINGEN_DG	10072428, 12588804, 14500541, 15831593, 19168852, 2009537, 2070412, 8236461, 9515965, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	UNIPROT_DG	10319582, 12216071, 17660459		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	ORPHANET_DG	19168852		★☆☆☆☆ Found in Text Mining only
Hereditary diffuse gastric cancer	Gastric Cancer	Orphanet			★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	15135482, 20471195		★☆☆☆☆ Found in Text Mining only
Hereditary Non-Polyposis Colon Cancer Type 2	Colorectal Cancer	CLINGEN_DG	10051639, 10072428, 11968083, 17221870, 26742007, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	CLINGEN_DG	10051639, 10072428, 11968083, 17221870, 26742007, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CLINGEN_DG	10051639, 10072428, 11968083, 17221870, 26742007, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	21134075, 27734215		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CLINGEN_DG	10051639, 10072428, 11968083, 17221870, 26742007, 9537325		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	11948460		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	28376813	Associate	★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	21459793		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	14675328	Inhibit	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	15228429, 15507671, 26683836	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20614262	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	39595551	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	31248429	Associate	★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14507651, 16740659, 17060462, 20010940, 20026874, 21680037, 23002349, 23050024, 24112779, 25096400, 25501705, 27044634, 28764685, 28991229, 30111297, 30556863, 30739528, 36243933	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21499308, 23322209, 25860915, 28794399, 29769799, 34624938	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34162953, 35603730	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22295148, 32843095, 32899090, 37798725	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35594338	Inhibit	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29218001		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	25150394	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10700430, 11408275, 32775420	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30140167		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	12631658, 15274329	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16080494	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	30553475		★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	25282623	Inhibit	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	11241409, 17550320		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	12127160, 14534701, 18662704, 20682973, 28993866, 29285016, 30008850, 30760857, 9365159		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	17660459, 8557030		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	20044998, 21752155		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21752155	Associate	★☆☆☆☆ Found in Text Mining only
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	30459467		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	21161401, 24023817		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	22912891	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24040439	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	38382928	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17645803, 28742884, 33846795	Associate	★☆☆☆☆ Found in Text Mining only
Kleefstra Syndrome	Kleefstra syndrome	Pubtator	39343771	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	12579297		★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	30046398		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21789704, 23975368, 24470282, 27689323, 27888826, 33336738, 38477084	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	16259108		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	24175817	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	20651304, 22685266		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	20651304	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	38376276	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10807790, 17964562		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10807790, 11175634, 15015578, 21102413, 24443786, 27374082, 9744888	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	16766511	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10807790	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23508577, 24164743, 27374082, 35747989	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12899712, 27374082	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15863205, 27305704, 27374082		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	11979414		★☆☆☆☆ Found in Text Mining only
Linitis Plastica	Linitis Plastica	BEFREE	11434599		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17660978, 21472888, 24274398, 29037125, 29538221		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11297254, 15151624, 15831995, 17548247, 18049164, 18723830, 18801366, 20625840, 21060828, 21462191, 22634315, 22962603, 23670717, 24013226, 24614035, 25975202, 26206264, 26280083, 26660680, 28422868, 29862272, 30206221, 30546442, 30898548, 31012192, 31383647, 8104855, 9139867		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12198663, 16474379, 18801083, 18842495		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	16474379	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39207047	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	9139867		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19293150, 25413006, 34727382	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32396269, 35418483	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33298584	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11068984, 11278651, 12937339, 14739904, 17409930, 17960794, 19056535, 19154401, 19177200, 19270647, 22752005, 22818553, 22933707, 23237220, 23244126, 23621211, 23724143, 24211838, 24505377, 24983967, 25446087, 25609022, 26498639, 26863455, 27655370, 28296173, 28577937, 28705116, 29118814, 29556623, 30060029, 30078010, 31066485, 31271097, 32441866, 33231090, 33416106, 33607820, 35159188, 35627232, 35628157, 36116043, 36402751, 37340370	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12937339, 15254707, 16614715, 18468719, 19056535		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16991125, 19118009		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24933634, 25163517, 28487957	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10424737, 12532436, 15918205, 17273727, 19048396, 19056535, 20025748, 20551954, 21574102, 21603980, 21639893, 22388757, 22692503, 23251464, 24816558, 25645984, 26617724, 27129576, 28459196, 28570699, 29556623, 29637533, 33035412, 33799604, 37369698	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10604738, 11068984, 12151719, 12460468, 12497652, 12532469, 12771988, 12888830, 15712207, 16237750, 17380028, 18327819, 18395897, 18473353, 18751390, 19050801, 19140237, 19192641, 19222093, 19448425, 20193117, 21148309, 22278155, 22458379, 23244128, 23621211, 24325792, 24399611, 24415879, 24696260, 24716905, 25518919, 25553984, 25854342, 26045832, 26285011, 26742007, 26842184, 26842802, 26918727, 27151709, 27356686, 27505247, 27600761, 27735037, 27888826, 28002521, 28906366, 29049198, 30290593, 30359996, 30534810, 30862505, 30989488, 31256188, 32348353, 32925786, 33607820, 33761659, 33789624, 36318684, 37699908, 37787034, 38358184, 39871234, 7534041, 8188077, 8883410	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12712492, 17649807	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	16426911		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19634113		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	24373500	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25226156		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25226156	Associate	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	21134075, 27734215		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17284367, 25161999		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	26237428		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	26237428		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15639718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10477433, 10584868, 11196175, 11729114, 11857408, 11912130, 11948460, 12127160, 12973049, 14534701, 15135482, 16116478, 16512896, 17611401, 17660459, 1793731, 18213475, 18418215, 18544963, 18701415, 19763817, 19834798, 19957299, 20568901, 20716965, 20921021, 21613543, 21681822, 22026417, 22297548, 22876288, 23276794, 23551055, 23575477, 23601657, 23709761, 24292671, 24528085, 24618085, 25039920, 25124632, 25591616, 25757734, 25758127, 25979631, 26182300, 26285011, 26425077, 26566278, 26666818, 26674224, 26694515, 26825466, 27174021, 27349965, 27500741, 27811364, 27852262, 27930738, 28135249, 28867731, 28979331, 29050223, 29285016, 29287594, 29348693, 29433565, 29732000, 30008850, 30616060, 30862505, 30954555, 31206626, 31420536, 8934538, 9581841, 9714050, 9744472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17520682, 19839049, 23921149, 24014025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12896902, 20874004, 22343305, 24068440, 25892250, 26963853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18751390, 20412959, 21373750, 26264242		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	20376482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10896919, 27268607		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	19011631, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	12579297, 27689323		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12467239, 15814621, 17960794, 19118009, 22799366, 22818553, 23244126, 23621211, 23706417, 24838315, 24906605, 24933634, 25810011, 25931811, 30127990, 30390382, 31207149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20674887, 21472888, 24274398, 29037125, 29538221		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	20462505		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14970867, 18035404, 19486012, 23572389, 26298390, 27067410, 28934230, 29113366, 29113377		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	8075649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11309315, 18223216, 22147512, 26191293, 29920275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	18223216		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11458121, 12209606, 12692786, 14630673, 14961571, 15026333, 15084762, 15741307, 16189707, 16327305, 16372334, 17138130, 17627168, 17656222, 18781193, 21694441, 23308245, 23682784, 25056535, 27420993, 28915599, 29536528, 30365107, 30880589, 31276688, 31850082, 9067271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16813949, 22581815, 29295717, 29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	17520682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10072428, 10749913, 11598162, 11705864, 11729114, 11968083, 11979414, 11998610, 12145417, 12209998, 12216071, 12444556, 12604719, 12908778, 12923325, 14610318, 14630673, 14998854, 15102685, 15135482, 15235021, 15288293, 15609397, 15780560, 16061854, 16273224, 16531765, 16555931, 16801346, 17311530, 17522512, 17545690, 17549573, 17660459, 17852867, 18249489, 18342503, 18427545, 18482459, 18544073, 18646324, 18798546, 19077564, 19474748, 19671196, 19674071, 20150736, 20632448, 20719348, 21106365, 21214416, 21271559, 21273772, 21570316, 21612411, 21625863, 21696387, 21838951, 22020549, 22160243, 22225527, 22228973, 22514028, 22535324, 22543498, 22581441, 22846738, 22936446, 22941158, 23264079, 23280118, 23341533, 23431106, 23435907, 23481202, 23752020, 23812922, 24011243, 24023308, 24204729, 24366306, 24389957, 24393364, 24424140, 24493355, 24510342, 24690483, 24728500, 25187893, 25340495, 25576241, 25599647, 25638682, 25771876, 25874772, 25882375, 25926721, 25981591, 26033320, 26072394, 26136075, 26334097, 26363540, 26674321, 27356686, 27706737, 27759617, 27861150, 27880784, 27899187, 28024868, 28522256, 28918030, 28993866, 29042646, 29131691, 29295527, 29434905, 29443099, 29589180, 30168144, 30642281, 30801717, 30963578, 30989488, 31077828, 31207149, 31246251, 8973475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	10072428, 12588804, 19168852, 19184424, 24816253, 9537325		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27250077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10891567, 11549575, 12203370, 16922727, 16934975, 18702824, 24404589, 24491043, 26901067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	17520682, 26901067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10593993, 11434599, 11705864, 11857408, 11948460, 11968084, 12767511, 12851691, 15135482, 15161659, 15203750, 15254707, 15457549, 15796198, 16116478, 16372334, 17034532, 17221870, 17720195, 17914577, 17971340, 18223216, 18342503, 18391748, 18418215, 18551395, 18684065, 19223545, 19432899, 19486012, 19634113, 19893985, 20332115, 20534996, 21271559, 21432908, 21435086, 21681551, 21706058, 21872467, 22002244, 22440943, 22792244, 23073328, 23197654, 23551055, 23621211, 23682784, 23849133, 24211838, 24373500, 24838934, 24870781, 25146682, 25599647, 25771876, 25873087, 25926721, 25931811, 26032781, 26182300, 26484421, 27067410, 27349965, 27420993, 27475839, 27566570, 27682981, 27811364, 27861150, 27899187, 28143883, 28266048, 28373167, 28376813, 28460635, 28522256, 29706558, 30091462, 30145018, 30390382, 30459467, 30745422, 31036696, 31685251, 31841163, 7748170, 9203946		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14750164, 17894941, 29085462, 29237293		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11535849, 16203744, 16283382, 19802011, 23900215, 23900729, 24454732, 26819089, 30594943		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	19011631, 31089142		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17520682, 19839049, 23921149, 24014025		★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	17660459, 8557030		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11912130, 12115723, 12127160, 12800196, 15161659, 15178462, 16495925, 16932944, 17649807, 17660459, 18321996, 18381934		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15178462, 21271559, 26674224, 27174021, 29610289, 31420536		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17520682, 19839049, 23921149, 24014025		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17520682, 19839049, 23921149, 24014025		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	32961817	Associate	★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17852707		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15029256, 17206475, 18551395, 31346954		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	15029256, 15508347, 18551395, 18664619	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	28843749		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10621837, 10793063, 11323412, 11900566, 12435856, 14984058, 15133476, 15610525, 15751018, 15855653, 17235241, 17611626, 19293150, 20098411, 20856146, 21738696, 21850018, 22022384, 23190890, 23208503, 24466036, 25595898, 26621846, 26672724, 26894856, 27234159, 27399772, 27612479, 27919967, 28056869, 29374154, 30393081, 31622599, 32200877, 33593721, 37623028, 38008393, 38113139	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12189238, 17013088, 18563342, 18829543		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12189238, 33744299, 34769150	Inhibit	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16204047, 24580015, 26329581, 28843749		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	15696778		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17905526, 19908067		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17905526, 19703993, 20574529, 23029385, 26825133, 37925427	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25333347	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	31322546	Inhibit	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11900566, 12194995, 15608393	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	15639718		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21305058, 26689197, 27705913, 30111297, 34638565	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	33260674	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	31318984, 31441503		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	31318984, 34788397	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	17213358		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11966474, 25386850, 26484421, 34706517	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16760327	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21639893, 22252571, 23250779, 23840677, 23936352, 28393810, 29037125, 32102518, 32495878, 32568177, 32928102, 34534039, 36849997, 39849873	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	LHGDN	12021924, 12694354		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	15999364		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	23320886		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	8774128	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15197802, 15274395, 17213358, 27655696, 35646332	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17213358, 19302404, 19548309, 27069257, 27655696		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29503661		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16343268		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18316853, 26025663	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22002244		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	24378265	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	35064929	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	29273724	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	27393708, 29746583, 31839751, 32047813, 34953475, 37382248	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28804222	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12632081, 12751385, 15361301, 17201146, 18632221, 18751390, 20462505, 21059597, 28004426		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17192051, 17201146, 18751390, 21240516, 24586173, 24935589, 26097576, 28198387, 29693120, 30338802, 31512056, 31557058, 32964976, 33965547, 34080661, 34841830, 34894048, 35421264, 37208923	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27108809	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10203750, 10211998, 10433926, 10451696, 11291078, 11297254, 11304579, 11313896, 11549575, 11562785, 11597316, 11857019, 11857408, 11879552, 12154064, 12163387, 12198663, 12409641, 12433278, 12569599, 12692786, 14534701, 14559984, 14610055, 14661064, 14750169, 15044918, 15073103, 15172980, 15178462, 15203750, 15289362, 15313375, 15354217, 15361301, 15788661, 15814621, 16203744, 16259108, 16353169, 16598757, 16600987, 16610016, 16699861, 16804902, 16830381, 17009983, 17221870, 17272309, 17327688, 17434710, 17609302, 17645803, 17852867, 17873891, 17971340, 18162763, 18197935, 18264082, 18427545, 18451216, 18503162, 18551395, 18646324, 18662704, 18701415, 18711702, 18788075, 18820662, 18980977, 19191266, 19269290, 19427668, 19657672, 19671196, 19748854, 19763817, 19789364, 19799609, 19802011, 19893985, 19908067, 20015323, 20173740, 20335450, 20462505, 20568901, 20729138, 20856229, 20871592, 21060828, 21106365, 21127944, 21134075, 21214416, 21308683, 21373750, 21706058, 21777349, 22002244, 22228973, 22297548, 22326525, 22514028, 22549391, 22569286, 22692503, 22777354, 22799366, 23144318, 23251464, 23308245, 23315031, 23324272, 23341533, 23432814, 23670162, 23800731, 23996076, 24127122, 24292671, 24361215, 24618085, 24998851, 25124632, 25210796, 25315765, 25367268, 25428551, 25492890, 25599647, 25704628, 25757734, 25908636, 26062653, 26085088, 26329581, 26363785, 26425077, 26455319, 26514616, 26666818, 26674224, 26674321, 26742007, 26759166, 26795349, 26820701, 26963853, 27067410, 27070496, 27174021, 27716369, 27783992, 27861150, 28143883, 28294427, 28373167, 28498287, 28631567, 28649475, 28650484, 28750639, 28934230, 28972040, 29032073, 29100362, 29113366, 29113377, 29161242, 29207084, 29250973, 29700408, 29735912, 29749455, 30046398, 30091462, 30100382, 30321884, 30390382, 30396569, 30452490, 30468908, 30624179, 30642281, 30880750, 30952738, 31048690, 31300294, 31444332, 31467357, 31690419, 31771969, 8127895, 8985087, 9195232, 9203946, 9458351, 9463572		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	10072428, 10477433, 11291078, 11348595, 11729114, 11948460, 11968084, 12824398, 15138207, 15235021, 15457549, 15831593, 15955779, 16061854, 16924464, 17221870, 17522512, 17545690, 17634464, 17660459, 18046629, 18391748, 18427545, 19223545, 19268661, 19269290, 19725995, 19965908, 20233471, 20371349, 20373070, 20719348, 21424370, 21681551, 21696387, 22020549, 22225527, 22723466, 22850631, 23073328, 23264079, 23709761, 23752020, 24204729, 24366306, 24389957, 24424122, 25123297, 25315765, 25525159, 25979631, 26025002, 26072394, 26182300, 26270727, 26681312, 27064202, 27582386, 27682646, 27752808, 27995193, 28195815, 28202063, 8127895, 9537325, 9751616		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	LHGDN	18046629		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	30066183, 31467357		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23298185, 23945386, 31114995		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	21161401, 24023817		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	Pubtator	24023817	Associate	★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	21161401		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17570703		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22580460, 28393230, 35531888	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31785347		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31318984		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	11900566	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	12632081		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31311600		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12140137, 12467239, 15254707, 18349282, 22799366, 23102249, 23621211, 23945386, 25373410, 25758052, 28631567, 28968839, 30148675, 30390382, 31124298, 31202850		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23062488		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	22888908	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27485598, 27597141, 30423024		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	21127944		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	20357201		★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	BEFREE	27227907		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	23250779, 37147960	Associate	★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	23197654, 26123647, 28301459		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	24838934, 28151848, 28301459, 28550290, 32260281, 32710482, 39596675	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	21958417	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27566442		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37203779	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22006429, 24714960, 25339006, 27155790, 27532429, 28338204, 28388584, 29048621, 33401246, 38538251	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27155790, 28694763		★☆☆☆☆ Found in Text Mining only
OTOFACIOCERVICAL SYNDROME 1	Otofaciocervical Syndrome	BEFREE	23197654		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14970867		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	26684027, 28623900	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	14970867, 25150394, 26684027, 33218351	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16826427, 18035404		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18035404, 19486012, 23572389, 27067410, 28934230, 29113366, 29113377		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	8075649		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14507651, 14520463, 15367415, 18026186, 18559505, 19028702, 19048126, 19486012, 20583256, 20610539, 20797318, 21264259, 21996746, 22479527, 22543706, 23317244, 23554977, 23621216, 24244294, 24499657, 24785108, 25008268, 25108408, 25261255, 25296567, 25533808, 25894377, 25973134, 25975373, 26298390, 26684027, 26768617, 27097978, 27129169, 27612152, 27835572, 27977010, 28401704, 28601643, 28934230, 29271992, 29996940, 30058681, 30628686, 31389603, 31450846, 31655274, 32096174, 33437214, 33560870, 33629295, 33941323, 34027641, 34070214, 34071861, 34720069, 35379775, 36306595, 38179758	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29952249, 30653577, 32547317	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian papillary adenocarcinoma	Ovarian papillary adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11309315, 18223216, 22147512, 26191293, 29920275		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21992816, 29161242, 31177911		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12219004, 14599963, 17043655, 18223216		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	18223216		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31336236		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11401320, 12532469, 17354228, 18223216, 19302290, 19584296, 19608876, 20579395, 20589377, 21552209, 21909380, 22041584, 22064652, 22458379, 22901124, 23001948, 23359139, 23940742, 23992308, 24048788, 24878505, 25072505, 25421630, 25557640, 25690753, 25989272, 26191293, 26493999, 26842802, 26848980, 26918727, 27023625, 28103577, 30782064, 31373305, 31515968, 31988090, 32090981, 32303144, 37881431, 40305202, 9665481	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12434297, 17334348, 23674382, 40315568	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	26183380	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	20553257		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	11439369, 17724139, 22194161		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	40362680	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33791366	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	28875602	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	24953529, 29273724		★☆☆☆☆ Found in Text Mining only
Peg-shaped teeth	Peg-Shaped Teeth	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	21781454	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	21781454	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	36212929	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	1720352		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	30268789		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	20930352	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21047437	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31171626	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	12890743, 21518759, 26757261, 31570735	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	15796198		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	15796198	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	17873891		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	17873891, 26617803, 33203795	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	27735037	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	10747091, 14718571, 19259356, 28385574	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	30414501	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36436516, 37239438	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28143883		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	27069257		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	LHGDN	12481018		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	14961571		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	14961571, 16189707		★☆☆☆☆ Found in Text Mining only
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	14961571, 16189707		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11458121, 11753952, 12209606, 12692786, 14630673, 14961571, 15084762, 15741307, 16189707, 16327305, 16372334, 17138130, 17627168, 17656222, 18712716, 18781193, 21694441, 23266572, 23308245, 23682784, 25056535, 27420993, 28915599, 29536528, 30365107, 30880589, 31276688, 31850082, 9067271		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	31212363, 33031138	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	22581815		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10206308, 11792709, 12393869, 14511406, 15870707, 15958559, 15958594, 17979146, 18084254, 18618693, 20672324, 21281819, 21546539, 21694441, 21756376, 21964676, 22593181, 23227138, 23449978, 24122992, 24418088, 24619413, 24769209, 25189356, 25409297, 25630770, 25743258, 26037169, 26458958, 26485709, 27268646, 27356744, 27420993, 28417919, 28832071, 29164579, 29295717, 29300772, 30365107, 30531834, 30754655, 30864712, 30880589, 30899277, 31332950, 31738404, 31895690, 31977154, 32143478, 32489267, 33204367, 33214693, 33542227, 33799604, 34399719, 35204839, 35682554, 36243981, 36312753, 37929350, 8623909	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11705864, 12209606, 12393869, 14511406, 14695147, 14961571, 14991757, 16172196, 16189707, 16226102, 16301117, 16327305, 16372334, 17656222, 17979146, 18008331, 18459457, 18618693, 18781193		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16813949, 22581815, 29295717, 29610475		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23298185, 24896103	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31658259, 9067271		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26617803, 33416099	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	31318984	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	20596253		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24452374, 25745049, 31427443	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26081431, 29068985, 29581578, 36420658	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29200203		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	12397640		★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11568972, 18195710, 19641369, 28802251		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29277613		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	27129576	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	10092652, 33098307	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	35794510	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	12439911	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	25611270	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	17520682		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	23719484	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21390241, 30862685	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17409416	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	11733362, 11900566, 21809991, 24294365	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	15467754		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	32478482	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24726916, 30952738		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	34788397	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	20092957		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	27461702, 32615059, 38069214	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	24443268	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16316423, 31165469	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33416099	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	14559984, 22330421		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35263398	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24933634, 29115924		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15712207, 24933634, 26919626, 28212573, 8387530	Associate	★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	11597316, 26425077		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11477576, 14559984, 14985090, 16259108, 17034532, 18197935, 20729138, 25233932, 26790440, 30041611, 9458351		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12082610, 12532436, 14734465, 15328184, 15609307, 16152579, 16426911, 16761612, 17203182, 17647062, 18097581, 18197935, 18327819, 18516325, 18697202, 19148529		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	17520682		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11578811, 18697202, 21373750, 24874843, 26334393, 26349968, 28599478, 28693179, 30880778		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12888830, 15666322, 15685613, 16505783, 18473353, 18991282, 19147758, 19243631, 19336864, 19549906, 19915524, 20614262, 21939503, 22072429, 22161744, 22197995, 22252571, 22580338, 22748449, 22828609, 24045665, 24175817, 24470282, 24715175, 24716948, 24722213, 24887090, 24893577, 25333745, 25374218, 25518919, 25607384, 25749385, 25854342, 26018309, 26036622, 26045832, 26207647, 26214683, 26218314, 26464646, 26818837, 27027429, 27146732, 28319306, 28570699, 28574664, 28893350, 29053653, 29216196, 29250652, 29790687, 30041611, 30143678, 30527240, 30720172, 31222140, 31238980, 31256188, 31471883, 31861233, 31938073, 32238919, 32277605, 32794417, 33063904, 33761659, 33840648, 34212035, 34781814, 35219646, 35435359, 35478157, 35717615, 35951144, 36308176, 37077062, 37787034, 39442128, 9642258	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18711702, 21639893, 39849873, 40004538	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22692503, 23065281		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	28243114		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	16043897		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18711702, 19148529, 24887090, 30450674, 30624179		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24887090		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10072428, 11058874, 11313896, 11443625, 11496321, 11598162, 11705864, 11729114, 11968083, 11979414, 11998610, 12145417, 12209998, 12210063, 12216071, 12373604, 12444556, 12851691, 12908778, 12923325, 14610318, 14630673, 14750169, 14998854, 15102685, 15135482, 15235021, 15288293, 15457549, 15609397, 15712179, 15735979, 15780560, 16061854, 16273224, 16531765, 16555931, 16610016, 16801346, 16830381, 17311530, 17522512, 17545690, 17549573, 17660459, 17760721, 17852867, 18249489, 18342503, 18427545, 18482459, 18544073, 18768510, 18798546, 19077564, 19474748, 19671196, 19674071, 20150736, 20632448, 20719348, 21106365, 21214416, 21271559, 21273772, 21308683, 21570316, 21612411, 21625863, 21696387, 21838951, 22020549, 22104201, 22160243, 22225527, 22228973, 22514028, 22535324, 22543498, 22581441, 22846738, 22936446, 22941158, 23264079, 23280118, 23341533, 23431106, 23435907, 23481202, 23752020, 23812922, 23849133, 24011243, 24023308, 24204729, 24366306, 24389957, 24393364, 24424140, 24493355, 24690483, 24728500, 25187893, 25340495, 25576241, 25599647, 25638682, 25771876, 25874772, 25882375, 25926721, 25981591, 26033320, 26072394, 26136075, 26334097, 26363540, 26674321, 27356686, 27706737, 27759617, 27861150, 27880784, 27899187, 28024868, 28522256, 28918030, 28993866, 29042646, 29131691, 29295527, 29434905, 29443099, 29589180, 30168144, 30642281, 30963578, 30989488, 31077828, 31207149, 31246251, 8973475		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	12439911, 16948518, 18768510, 24528029, 26443527, 26568477, 34251444, 36064550	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	10072428, 12588804, 19168852, 19184424, 24816253, 9537325		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10206317, 10433926, 10551330, 10604738, 10682667, 10896919, 11194192, 11304579, 11305955, 11419427, 11747475, 11920500, 12151719, 12163364, 12439911, 12460468, 12631658, 12923325, 1333788, 14556664, 14610318, 14762482, 14998854, 15138199, 15138207, 15161014, 15235021, 15288293, 15330201, 15361706, 15378790, 15753528, 15800994, 15831593, 15902740, 15918205, 15942635, 16127748, 16237750, 16244541, 16521229, 16555931, 16610016, 16679349, 16801346, 16821608, 16830381, 17201188, 17224647, 17380028, 17483253, 17522512, 17552003, 17651578, 17660459, 17663505, 17708604, 17982235, 17986624, 18007144, 18246045, 18377425, 18442100, 18482459, 18683894, 18768510, 18798546, 19048396, 19050793, 19168852, 19674071, 19748854, 19940363, 19965908, 20529814, 20563765, 20566745, 20591882, 20842455, 20921021, 21114921, 21203466, 21333186, 21777278, 21992816, 22119833, 22415887, 22502664, 22514028, 22595728, 22738705, 22969242, 23049225, 23196062, 23280118, 23431106, 23484115, 23504025, 23555086, 23812922, 23840737, 24008668, 24081672, 24115825, 24197976, 24204729, 24325792, 24528029, 24568530, 24660577, 24684952, 24690483, 24696260, 24838934, 25089230, 25144746, 25187893, 25340522, 25388006, 25486483, 25694126, 25767376, 25874772, 25882375, 25967717, 26032781, 26182300, 26334097, 26443527, 26617790, 26674321, 26983597, 27032689, 27058427, 27256430, 27356686, 27542403, 27566570, 27706737, 27781410, 27855404, 27861150, 27880784, 28024868, 28076475, 28204904, 28209205, 28301459, 28381163, 28388558, 28459196, 28460635, 28485805, 28522256, 28534359, 28534934, 28611525, 28688938, 28832634, 28970725, 29025585, 29131691, 29138864, 29295527, 29361914, 29589180, 29622765, 29706558, 29717263, 29794962, 29798843, 29991048, 30063010, 30066183, 30068367, 30087428, 30134903, 30177679, 30311375, 30466290, 30547291, 30575909, 30642281, 30646925, 30720114, 30895400, 30963578, 30989488, 31164161, 31207149, 31273560, 31467357, 31509966, 31600923, 31658331, 31685251, 31767037, 31773716, 31814524, 31841163, 31876727, 31949278, 32156253, 32241597, 32260281, 32338015, 32348353, 32357145, 32362280, 32373959, 32489267, 32664545, 32886433, 32951272, 32997132, 33000178, 33048355, 33095797, 33095806, 33206267, 33511732, 33512806, 33578599, 33619332, 33655597, 33827469, 33886068, 33941229, 34075207, 34135208, 34367379, 34475120, 34551773, 34643667, 34672684, 34916374, 34949788, 35074963, 35076580, 35078942, 35327954, 35341446, 35448173, 35499650, 35596183, 35758029, 35771165, 35817563, 35831514, 35851744, 35856494, 35877235, 36063148, 36064550, 36087100, 36157109, 36203485, 36232418, 36436516, 36484990, 36509094, 36553480, 36562524, 36588491, 36600593, 36652613, 36833207, 36990610, 37094689, 37239438, 37249750, 37393258, 37436885, 37573302, 37587724, 37707375, 37794689, 37867380, 37903316, 37925632, 38050871, 38358184, 39521152, 39596675, 39674581, 40105370, 7862112, 8127895, 8797891, 9045944, 9792157	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12216071, 12444556, 15102685, 15102690, 15235021, 15780560, 16061854, 16132582, 16801346, 16870389, 17126523, 17221870, 17396032, 17545690, 17549573, 17660459, 17852867, 17981184, 18046629, 18312357, 18377425, 18427545, 18482459		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12414534, 18395897, 25822437, 27412620, 28983895, 30642281, 39206977, 8188525	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	20975737, 28376813		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29042646	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11733362, 15467754, 30959202		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	11733362, 15467754		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	18158575		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	16907861		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	16333245	Associate	★☆☆☆☆ Found in Text Mining only
Thoracic Neoplasms	Thoracic neoplasm	Pubtator	7819034	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	12839963		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	23264214	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	27409604	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23264214, 23324246	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25755746, 26097548, 29655286, 30175973, 30534810, 35871446	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17724139, 27250077		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25755746	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151, 35491899	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17431390		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27250077, 28926589, 8985087		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16224162, 19589279, 23264214, 25329121, 27273957, 31648166, 32698816, 32737449, 33813463, 33831503, 39179334	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24126800	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	24126800	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	11206273, 11900224, 27431199, 36074434	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12629411, 14501773, 18384629		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19531543, 22126395, 22638807, 23443971, 24390667, 25068292, 25953261, 26039245, 28802099, 29049198, 30338806, 30602372, 30628666, 32244385, 33650675, 34680970, 35551175, 35627188, 37885030, 38188675	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	20551954	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22213313, 24366407, 26062653, 28392805, 29100362, 29580241, 30008850, 30538542, 30883132		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31450894	Stimulate	★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	30591455		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	26619103, 34473724	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11171827, 12203775, 19915572, 21234761, 21300624, 21319274, 21744425, 26512799, 9203946		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	19915572		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942, 17520682, 8075649		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	9045944		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	18683894, 20880515, 23231047		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	16367920	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10390008, 11549575, 27058893, 28232500, 29620261, 7745120	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10901372, 11737053, 12357319, 16675571, 17201133, 17404085, 18702824, 18980977, 22253920, 22903481, 23239884, 24325461, 24571540, 24856504, 25826491, 25884322, 26643891, 26901067, 27322434, 27402302, 27473264, 27683053, 29517839, 29532898, 29610393, 29739919, 30003751, 30475758, 31500788, 32214283, 34565009, 36074678, 36131343, 37706625, 7768969, 8761373, 9176385, 9223755	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	31318984	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	Pubtator	25329457	Inhibit	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	29055055		★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	20421722, 22951176, 31291718	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12773202, 17894941, 23826417, 24998916, 26183380, 27223886, 27837621	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17906929		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12773202, 16803511, 16928264, 17009983, 17894941, 19690767, 20495745, 22942707, 23322209, 24058594, 24751719, 25007342, 25330011, 25380749, 25988335, 27902484, 28252165, 28921916, 29207526, 29470526, 29587669, 29899322, 29989651, 30198868, 30720157, 30853662, 31256433, 33649791, 36088372, 37505767, 9218005	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14675348	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25282623, 33249961, 35303800, 37047609	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20651370, 26880767		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	30091462	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35426938	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	25282623	Inhibit	★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	24516707	Associate	★☆☆☆☆ Found in Text Mining only
Velopharyngeal Insufficiency	Velopharyngeal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	25613741, 30890477		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29024688	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	25613741, 30890477		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	26901067, 29781067, 30865491, 31638990, 33473164, 40349989	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	31054897, 33237989	Inhibit	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	21127944		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12890743, 31114995, 37904849	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	20651370		★☆☆☆☆ Found in Text Mining only