Gene Gene information from NCBI Gene database.
Entrez ID 5134
Gene name Programmed cell death 2
Gene symbol PDCD2
Synonyms (NCBI Gene)
RP8ZMYND7
Chromosome 6
Chromosome location 6q27
Summary This gene encodes a nuclear protein expressed in a variety of tissues. Expression of this gene has been shown to be repressed by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor required for lymph node germinal center development, suggesting that
miRNA miRNA information provided by mirtarbase database.
56
miRTarBase ID miRNA Experiments Reference
MIRT054135 hsa-miR-129-1-3p Luciferase reporter assayqRT-PCRWestern blot 25111461
MIRT054135 hsa-miR-129-1-3p Luciferase reporter assayqRT-PCRWestern blot 25111461
MIRT054135 hsa-miR-129-1-3p Luciferase reporter assayqRT-PCRWestern blot 25111461
MIRT054135 hsa-miR-129-1-3p Luciferase reporter assayqRT-PCRWestern blot 25111461
MIRT1219276 hsa-miR-1197 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
BCL6 Repression 20605493
BCL6 Unknown 11854457;17468402
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 19146857, 28514442, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600866 8762 ENSG00000071994
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16342
Protein name Programmed cell death protein 2 (Zinc finger MYND domain-containing protein 7) (Zinc finger protein Rp-8)
Protein function May be a DNA-binding protein with a regulatory function. May play an important role in cell death and/or in regulation of cell proliferation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01753 zf-MYND 135 172 MYND finger Domain
PF04194 PDCD2_C 189 339 Programmed cell death protein 2, C-terminal putative domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQD
VTDTP
Sequence length 344
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOGENOUS DEPRESSION Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 16609906
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 16609906
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 12800155
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 21320484
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 37338518 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 12536316
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 30664177 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 12536316, 16609906
★☆☆☆☆
Found in Text Mining only
Depressive Disorder Major depressive disorder Pubtator 19955554 Stimulate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent Diabetes Mellitus BEFREE 15848047
★☆☆☆☆
Found in Text Mining only