Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51330
Gene name	TNF receptor superfamily member 12A
Gene symbol	TNFRSF12A
Synonyms (NCBI Gene)	CD266FN14TWEAKR
Chromosome	16
Chromosome location	16p13.3

221

Show/Hide all (221)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022342	hsa-miR-124-3p	Microarray	18668037
MIRT031460	hsa-miR-16-5p	Proteomics	18668040
MIRT042306	hsa-miR-484	CLASH	23622248
MIRT665701	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT665700	hsa-miR-92a-1-5p	HITS-CLIP	23824327
MIRT665699	hsa-miR-203a-5p	HITS-CLIP	23824327
MIRT665698	hsa-miR-1273g-5p	HITS-CLIP	23824327
MIRT142988	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT142989	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT142988	hsa-miR-19a-3p	Luciferase reporter assayqRT-PCRWestern blot	26367773
MIRT142989	hsa-miR-19b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32696503
MIRT665701	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT665700	hsa-miR-92a-1-5p	HITS-CLIP	23824327
MIRT665699	hsa-miR-203a-5p	HITS-CLIP	23824327
MIRT665698	hsa-miR-1273g-5p	HITS-CLIP	23824327
MIRT1442883	hsa-miR-105	CLIP-seq
MIRT1442884	hsa-miR-1207-3p	CLIP-seq
MIRT1442885	hsa-miR-1255a	CLIP-seq
MIRT1442886	hsa-miR-1255b	CLIP-seq
MIRT1442887	hsa-miR-1272	CLIP-seq
MIRT1442888	hsa-miR-1275	CLIP-seq
MIRT1442889	hsa-miR-1299	CLIP-seq
MIRT1442890	hsa-miR-1470	CLIP-seq
MIRT1442891	hsa-miR-149	CLIP-seq
MIRT1442892	hsa-miR-1827	CLIP-seq
MIRT1442893	hsa-miR-1913	CLIP-seq
MIRT1442894	hsa-miR-1914	CLIP-seq
MIRT1442895	hsa-miR-1915	CLIP-seq
MIRT1442896	hsa-miR-19a	CLIP-seq
MIRT1442897	hsa-miR-19b	CLIP-seq
MIRT1442898	hsa-miR-204	CLIP-seq
MIRT1442899	hsa-miR-2052	CLIP-seq
MIRT1442900	hsa-miR-211	CLIP-seq
MIRT1442901	hsa-miR-2110	CLIP-seq
MIRT1442902	hsa-miR-2467-5p	CLIP-seq
MIRT1442903	hsa-miR-3150a-3p	CLIP-seq
MIRT1442904	hsa-miR-3165	CLIP-seq
MIRT1442905	hsa-miR-3173-3p	CLIP-seq
MIRT1442906	hsa-miR-3175	CLIP-seq
MIRT1442907	hsa-miR-3188	CLIP-seq
MIRT1442908	hsa-miR-3192	CLIP-seq
MIRT1442909	hsa-miR-3200-5p	CLIP-seq
MIRT1442910	hsa-miR-3202	CLIP-seq
MIRT1442911	hsa-miR-324-3p	CLIP-seq
MIRT1442912	hsa-miR-331-3p	CLIP-seq
MIRT1442913	hsa-miR-346	CLIP-seq
MIRT1442914	hsa-miR-3612	CLIP-seq
MIRT1442915	hsa-miR-361-3p	CLIP-seq
MIRT1442916	hsa-miR-3616-3p	CLIP-seq
MIRT1442917	hsa-miR-3689a-3p	CLIP-seq
MIRT1442918	hsa-miR-3689c	CLIP-seq
MIRT1442919	hsa-miR-3691-3p	CLIP-seq
MIRT1442920	hsa-miR-3918	CLIP-seq
MIRT1442921	hsa-miR-3975	CLIP-seq
MIRT1442922	hsa-miR-4255	CLIP-seq
MIRT1442923	hsa-miR-4259	CLIP-seq
MIRT1442924	hsa-miR-4260	CLIP-seq
MIRT1442925	hsa-miR-4279	CLIP-seq
MIRT1442926	hsa-miR-4287	CLIP-seq
MIRT1442927	hsa-miR-4292	CLIP-seq
MIRT1442928	hsa-miR-4302	CLIP-seq
MIRT1442929	hsa-miR-4313	CLIP-seq
MIRT1442930	hsa-miR-4314	CLIP-seq
MIRT1442931	hsa-miR-4316	CLIP-seq
MIRT1442932	hsa-miR-4436a	CLIP-seq
MIRT1442933	hsa-miR-4463	CLIP-seq
MIRT1442934	hsa-miR-4469	CLIP-seq
MIRT1442935	hsa-miR-4476	CLIP-seq
MIRT1442936	hsa-miR-4512	CLIP-seq
MIRT1442937	hsa-miR-4533	CLIP-seq
MIRT1442938	hsa-miR-4646-5p	CLIP-seq
MIRT1442939	hsa-miR-4652-3p	CLIP-seq
MIRT1442940	hsa-miR-4665-5p	CLIP-seq
MIRT1442941	hsa-miR-4667-3p	CLIP-seq
MIRT1442942	hsa-miR-4682	CLIP-seq
MIRT1442943	hsa-miR-4685-3p	CLIP-seq
MIRT1442944	hsa-miR-4685-5p	CLIP-seq
MIRT1442945	hsa-miR-4697-3p	CLIP-seq
MIRT1442946	hsa-miR-4713-5p	CLIP-seq
MIRT1442947	hsa-miR-4728-5p	CLIP-seq
MIRT1442948	hsa-miR-4742-3p	CLIP-seq
MIRT1442949	hsa-miR-4757-5p	CLIP-seq
MIRT1442950	hsa-miR-4779	CLIP-seq
MIRT1442951	hsa-miR-4782-5p	CLIP-seq
MIRT1442952	hsa-miR-485-5p	CLIP-seq
MIRT1442953	hsa-miR-516b	CLIP-seq
MIRT1442954	hsa-miR-548c-3p	CLIP-seq
MIRT1442955	hsa-miR-571	CLIP-seq
MIRT1442956	hsa-miR-650	CLIP-seq
MIRT1442957	hsa-miR-760	CLIP-seq
MIRT1442958	hsa-miR-892b	CLIP-seq
MIRT1442959	hsa-miR-939	CLIP-seq
MIRT1442883	hsa-miR-105	CLIP-seq
MIRT1442894	hsa-miR-1914	CLIP-seq
MIRT1442896	hsa-miR-19a	CLIP-seq
MIRT1442897	hsa-miR-19b	CLIP-seq
MIRT1442912	hsa-miR-331-3p	CLIP-seq
MIRT1442883	hsa-miR-105	CLIP-seq
MIRT1442884	hsa-miR-1207-3p	CLIP-seq
MIRT2132545	hsa-miR-1207-5p	CLIP-seq
MIRT2132546	hsa-miR-1225-3p	CLIP-seq
MIRT1442885	hsa-miR-1255a	CLIP-seq
MIRT1442886	hsa-miR-1255b	CLIP-seq
MIRT1442887	hsa-miR-1272	CLIP-seq
MIRT1442888	hsa-miR-1275	CLIP-seq
MIRT2132547	hsa-miR-147	CLIP-seq
MIRT1442891	hsa-miR-149	CLIP-seq
MIRT1442892	hsa-miR-1827	CLIP-seq
MIRT2132548	hsa-miR-1909	CLIP-seq
MIRT1442894	hsa-miR-1914	CLIP-seq
MIRT1442896	hsa-miR-19a	CLIP-seq
MIRT1442897	hsa-miR-19b	CLIP-seq
MIRT1442898	hsa-miR-204	CLIP-seq
MIRT1442899	hsa-miR-2052	CLIP-seq
MIRT1442900	hsa-miR-211	CLIP-seq
MIRT1442901	hsa-miR-2110	CLIP-seq
MIRT2132549	hsa-miR-2113	CLIP-seq
MIRT1442902	hsa-miR-2467-5p	CLIP-seq
MIRT1442903	hsa-miR-3150a-3p	CLIP-seq
MIRT1442905	hsa-miR-3173-3p	CLIP-seq
MIRT1442906	hsa-miR-3175	CLIP-seq
MIRT1442907	hsa-miR-3188	CLIP-seq
MIRT1442912	hsa-miR-331-3p	CLIP-seq
MIRT1442916	hsa-miR-3616-3p	CLIP-seq
MIRT1442921	hsa-miR-3975	CLIP-seq
MIRT1442923	hsa-miR-4259	CLIP-seq
MIRT1442924	hsa-miR-4260	CLIP-seq
MIRT1442926	hsa-miR-4287	CLIP-seq
MIRT1442928	hsa-miR-4302	CLIP-seq
MIRT1442929	hsa-miR-4313	CLIP-seq
MIRT1442931	hsa-miR-4316	CLIP-seq
MIRT1442935	hsa-miR-4476	CLIP-seq
MIRT2132550	hsa-miR-4481	CLIP-seq
MIRT1442937	hsa-miR-4533	CLIP-seq
MIRT2132551	hsa-miR-4640-5p	CLIP-seq
MIRT2132552	hsa-miR-4649-5p	CLIP-seq
MIRT1442939	hsa-miR-4652-3p	CLIP-seq
MIRT1442940	hsa-miR-4665-5p	CLIP-seq
MIRT1442941	hsa-miR-4667-3p	CLIP-seq
MIRT1442943	hsa-miR-4685-3p	CLIP-seq
MIRT1442945	hsa-miR-4697-3p	CLIP-seq
MIRT2132553	hsa-miR-4707-5p	CLIP-seq
MIRT2132554	hsa-miR-4726-5p	CLIP-seq
MIRT2132555	hsa-miR-4736	CLIP-seq
MIRT1442948	hsa-miR-4742-3p	CLIP-seq
MIRT2132556	hsa-miR-4745-5p	CLIP-seq
MIRT2132557	hsa-miR-4758-5p	CLIP-seq
MIRT2132558	hsa-miR-4763-3p	CLIP-seq
MIRT1442950	hsa-miR-4779	CLIP-seq
MIRT1442952	hsa-miR-485-5p	CLIP-seq
MIRT1442955	hsa-miR-571	CLIP-seq
MIRT2132559	hsa-miR-599	CLIP-seq
MIRT1442957	hsa-miR-760	CLIP-seq
MIRT1442958	hsa-miR-892b	CLIP-seq
MIRT1442959	hsa-miR-939	CLIP-seq
MIRT2132560	hsa-miR-940	CLIP-seq
MIRT1442883	hsa-miR-105	CLIP-seq
MIRT1442884	hsa-miR-1207-3p	CLIP-seq
MIRT2132545	hsa-miR-1207-5p	CLIP-seq
MIRT1442887	hsa-miR-1272	CLIP-seq
MIRT1442888	hsa-miR-1275	CLIP-seq
MIRT1442892	hsa-miR-1827	CLIP-seq
MIRT1442893	hsa-miR-1913	CLIP-seq
MIRT1442894	hsa-miR-1914	CLIP-seq
MIRT1442895	hsa-miR-1915	CLIP-seq
MIRT1442896	hsa-miR-19a	CLIP-seq
MIRT1442897	hsa-miR-19b	CLIP-seq
MIRT1442899	hsa-miR-2052	CLIP-seq
MIRT1442901	hsa-miR-2110	CLIP-seq
MIRT2132549	hsa-miR-2113	CLIP-seq
MIRT2353506	hsa-miR-296-5p	CLIP-seq
MIRT1442903	hsa-miR-3150a-3p	CLIP-seq
MIRT2353507	hsa-miR-3151	CLIP-seq
MIRT1442905	hsa-miR-3173-3p	CLIP-seq
MIRT2353508	hsa-miR-3174	CLIP-seq
MIRT1442906	hsa-miR-3175	CLIP-seq
MIRT1442909	hsa-miR-3200-5p	CLIP-seq
MIRT1442911	hsa-miR-324-3p	CLIP-seq
MIRT1442912	hsa-miR-331-3p	CLIP-seq
MIRT1442913	hsa-miR-346	CLIP-seq
MIRT1442915	hsa-miR-361-3p	CLIP-seq
MIRT1442916	hsa-miR-3616-3p	CLIP-seq
MIRT1442919	hsa-miR-3691-3p	CLIP-seq
MIRT1442920	hsa-miR-3918	CLIP-seq
MIRT2353509	hsa-miR-4257	CLIP-seq
MIRT1442923	hsa-miR-4259	CLIP-seq
MIRT1442924	hsa-miR-4260	CLIP-seq
MIRT1442927	hsa-miR-4292	CLIP-seq
MIRT1442928	hsa-miR-4302	CLIP-seq
MIRT1442929	hsa-miR-4313	CLIP-seq
MIRT1442935	hsa-miR-4476	CLIP-seq
MIRT2132550	hsa-miR-4481	CLIP-seq
MIRT1442936	hsa-miR-4512	CLIP-seq
MIRT1442937	hsa-miR-4533	CLIP-seq
MIRT2132551	hsa-miR-4640-5p	CLIP-seq
MIRT2353510	hsa-miR-4650-5p	CLIP-seq
MIRT1442940	hsa-miR-4665-5p	CLIP-seq
MIRT1442942	hsa-miR-4682	CLIP-seq
MIRT1442944	hsa-miR-4685-5p	CLIP-seq
MIRT1442945	hsa-miR-4697-3p	CLIP-seq
MIRT2132554	hsa-miR-4726-5p	CLIP-seq
MIRT1442948	hsa-miR-4742-3p	CLIP-seq
MIRT2132556	hsa-miR-4745-5p	CLIP-seq
MIRT1442949	hsa-miR-4757-5p	CLIP-seq
MIRT2132557	hsa-miR-4758-5p	CLIP-seq
MIRT2132558	hsa-miR-4763-3p	CLIP-seq
MIRT2353511	hsa-miR-4765	CLIP-seq
MIRT1442950	hsa-miR-4779	CLIP-seq
MIRT1442955	hsa-miR-571	CLIP-seq
MIRT2132559	hsa-miR-599	CLIP-seq
MIRT1442959	hsa-miR-939	CLIP-seq
MIRT2132560	hsa-miR-940	CLIP-seq
MIRT1442883	hsa-miR-105	CLIP-seq
MIRT1442896	hsa-miR-19a	CLIP-seq
MIRT1442897	hsa-miR-19b	CLIP-seq
MIRT1442904	hsa-miR-3165	CLIP-seq
MIRT1442909	hsa-miR-3200-5p	CLIP-seq
MIRT1442932	hsa-miR-4436a	CLIP-seq
MIRT2132550	hsa-miR-4481	CLIP-seq
MIRT2132556	hsa-miR-4745-5p	CLIP-seq
MIRT2132557	hsa-miR-4758-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
MAML1	Repression	18503747
NR1I2	Activation	21072196

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001726	Component	Ruffle	IEA
GO:0005515	Function	Protein binding	IPI	11728344, 21525013, 23438059, 25416956, 31515488, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006931	Process	Substrate-dependent cell migration, cell attachment to substrate	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21525013
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0061041	Process	Regulation of wound healing	IDA	11728344
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013

MIM	HGNC	e!Ensembl
605914	18152	ENSG00000006327

Q9NP84

Protein name

Tumor necrosis factor receptor superfamily member 12A (Fibroblast growth factor-inducible immediate-early response protein 14) (FGF-inducible 14) (Tweak-receptor) (TweakR) (CD antigen CD266)

Protein function

Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.

PDB

2EQP , 2KMZ , 2RPJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12191	stn_TNFRSF12A	1 → 129	Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.

Sequence

MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPAVALIQ

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (167)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	23052191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17594693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17594693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23077618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38256230, 40595248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	24970477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17127278, 17485328, 20810696, 28781615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19147618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27653285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	19147618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19147618, 21435232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29143982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35606385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16809572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17127278, 17485328, 20810696, 28781615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	21852085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	15353286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24056367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24130833, 26659091, 28636775, 31212034		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24408972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28620393, 28899632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28180936, 31549181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15611130, 29453678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29453678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33991013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22767506, 23378579, 23722548, 25239934, 26497551, 29250484, 30142200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18505918, 25375638, 30142200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28351660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	27441657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29250484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23886137, 28138696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24469836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21483105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22438963, 30414907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31023317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29971943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	19349318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29249219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17917114, 20068578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38277520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18793781, 20557950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	28620393, 28899632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	23462911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	23750247, 26931128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27441657, 29190188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	35163208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	21483105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26012567, 27634763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28180936, 31549181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22752727, 27409295, 29981796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21483105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	24467773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29038621, 31515807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31515807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30038329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24467773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32846846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16503147, 20382683, 27441657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	34274346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31515807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20189297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	34517088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic ataxia type 1	Episodic ataxia	BEFREE	31212034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	17594693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37657050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28180936, 28358987, 31549181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29346801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12651623, 15611130, 19861406, 22571869, 23775076, 26300004, 28887134, 29453678, 29897522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12651623, 29453678	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15611130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15611130, 19861406, 29724813, 40595248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12651623, 15611130, 19861406, 22571869, 23775076, 26300004, 28887134, 29453678, 29724813, 29897522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12651623, 15611130, 17018610, 19861406, 22571869, 23775076, 23975833, 24376672, 26300004, 26764186, 28103571, 29453678, 29724813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12651623, 17018610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12651623, 15611130, 23775076, 26764186, 29453678, 29741404, 33991013, 35592520, 40595248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	29897522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26012567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28636775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22752727, 27409295, 29981796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	21697814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20382683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29706927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34948231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28910745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	22314077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26012567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29038621, 31515807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17917114, 18793781, 20557950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23999007, 27353019, 29190188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21697814, 23093094, 29588419, 31017010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	23052191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	24469836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10751351, 22521346, 23886137, 24130833, 28138696, 28455246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24469836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	28620393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26659091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	21303425, 21697814, 22727560, 22896023, 27595519, 27786399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27350337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17018610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	26300004, 29453678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22767506, 23378579, 23722548, 25239934, 25375638, 29250484, 30142200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20189297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10751351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24469836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23469193, 31023317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21828059, 23077618, 24970477, 31500625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21993017, 24337061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15611130, 17127278, 21993017, 22850567, 23469193, 24469836, 25054270, 25239934, 27254081, 27821799, 28138696, 28357912, 29054986, 29897522, 31580829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18505918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21586630, 23378579		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23190886, 27821799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	22896023, 23999007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	29326686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17917114, 19018248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35561450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	22128161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	20082609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	22314077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	25504044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	33991013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10751351, 12496418, 12651623, 17127278, 17594693, 21586630, 22634180, 23190886, 23722548, 23775076, 23886137, 23974006, 24130833, 24376672, 24710956 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	22896023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22634180, 24469836, 24710956, 25392346, 27350337, 29500337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16503147, 20382683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20382683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	20068578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30014744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30014744, 40383808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23469193, 31023317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23469193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30414611		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24599047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	28351660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	17100776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27050952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38256230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	24467773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	22637703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27050952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21828059, 23077618, 24970477, 31500625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31500625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	22438963	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30038329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28562476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21483105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24408972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17127278, 22055894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28562476, 31017010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	30648117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22438963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31515807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25054270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32719094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30414907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24858806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21993017, 24337061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26945694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	30576385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30414611, 34767591, 35515000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32846846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25239934, 28715634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	19018248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38216619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22850567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39224598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	27441657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	32461624	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFRSF12A (TNF receptor superfamily member 12A)