PDCD1 (programmed cell death 1)

Gene

• Entrez ID: 5133
• Gene name: Programmed cell death 1
• Gene symbol: PDCD1
• Synonyms (NCBI Gene): ADMIO4, AIMTBS, CD279, PD-1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
• Chromosome: 2
• Chromosome location: 2q37.3
• Summary: Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	22927820
MIRT542830	hsa-miR-922	HITS-CLIP	22927820
MIRT542829	hsa-miR-4514	HITS-CLIP	22927820
MIRT542828	hsa-miR-4692	HITS-CLIP	22927820
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	24906430
MIRT542830	hsa-miR-922	HITS-CLIP	24906430
MIRT542829	hsa-miR-4514	HITS-CLIP	24906430
MIRT542828	hsa-miR-4692	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	24906430
MIRT542830	hsa-miR-922	HITS-CLIP	24906430
MIRT542829	hsa-miR-4514	HITS-CLIP	24906430
MIRT542828	hsa-miR-4692	HITS-CLIP	24906430
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	28735896
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	22927820
MIRT542830	hsa-miR-922	HITS-CLIP	22927820
MIRT542829	hsa-miR-4514	HITS-CLIP	22927820
MIRT542828	hsa-miR-4692	HITS-CLIP	22927820
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	21572407
MIRT1219215	hsa-miR-1254	CLIP-seq
MIRT1219216	hsa-miR-1291	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219221	hsa-miR-3116	CLIP-seq
MIRT1219222	hsa-miR-3151	CLIP-seq
MIRT1219223	hsa-miR-3940-3p	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219225	hsa-miR-4252	CLIP-seq
MIRT1219226	hsa-miR-4283	CLIP-seq
MIRT1219227	hsa-miR-4300	CLIP-seq
MIRT1219228	hsa-miR-4456	CLIP-seq
MIRT1219229	hsa-miR-4489	CLIP-seq
MIRT1219230	hsa-miR-4675	CLIP-seq
MIRT1219231	hsa-miR-4688	CLIP-seq
MIRT1219232	hsa-miR-4741	CLIP-seq
MIRT1219233	hsa-miR-4755-3p	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219235	hsa-miR-541	CLIP-seq
MIRT1219236	hsa-miR-548q	CLIP-seq
MIRT1219237	hsa-miR-550a	CLIP-seq
MIRT1219238	hsa-miR-654-5p	CLIP-seq
MIRT1219239	hsa-miR-661	CLIP-seq
MIRT1219240	hsa-miR-920	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT2291849	hsa-miR-1913	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT2291850	hsa-miR-3189-5p	CLIP-seq
MIRT2291851	hsa-miR-324-3p	CLIP-seq
MIRT2291852	hsa-miR-342-5p	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT2291853	hsa-miR-4512	CLIP-seq
MIRT2291854	hsa-miR-4664-5p	CLIP-seq
MIRT2291855	hsa-miR-4758-3p	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT2291856	hsa-miR-670	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001783	Process	B cell apoptotic process	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002644	Process	Negative regulation of tolerance induction	IEA
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	38377992
GO:0002903	Process	Negative regulation of B cell apoptotic process	IEA
GO:0005515	Function	Protein binding	IPI	15240681, 17489864, 20587542, 21982860, 23417675, 26602187, 28046066, 30487606
GO:0005886	Component	Plasma membrane	IDA	30487606
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1396582
GO:0006959	Process	Humoral immune response	TAS	9332365
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IDA	21276005, 38377992
GO:0050776	Process	Regulation of immune response	IBA
GO:0050777	Process	Negative regulation of immune response	IEA
GO:0050777	Process	Negative regulation of immune response	ISS
GO:0050868	Process	Negative regulation of T cell activation	IDA	21276005, 38377992
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IBA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IEA
GO:1902482	Process	Regulatory T cell apoptotic process	IEA

Other IDs

• MIM: 600244
• HGNC: 8760
• e!Ensembl: ENSG00000188389

Protein

• UniProt ID: Q15116
• Protein name: Programmed cell death protein 1 (Protein PD-1) (hPD-1) (CD antigen CD279)
• Protein function: Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed:21276005, PubMed:37208329). Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/
• PDB: 2M2D, 3RRQ, 4ZQK, 5B8C, 5GGR, 5GGS, 5IUS, 5JXE, 5WT9, 6HIG, 6J14, 6J15, 6JBT, 6JJP, 6K0Y, 6R5G, 6ROY, 6ROZ, 6UMT, 6UMU, 6UMV, 6XKR, 7BXA, 7CGW, 7CU5, 7E9B, 7VUX, 7WSL, 7WVM, 8AS0, 8EQ6, 8GY5, 8U31, 8U32, 9HK1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	37 → 145	Immunoglobulin V-set domain	Domain

• Sequence:

  MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
  ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
  YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
  LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
  CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL

• Sequence length: 288

Pathways

KEGG:

Cell adhesion molecules
T cell receptor signaling pathway
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

PD-1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	ClinGen, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 4	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PDCD1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECLASSIFIED - PDCD1 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	28705256		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	29509940		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26081225, 26134222, 26183759, 27403614, 29675791, 30616523		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28429196		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29332341		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27346415, 28039262, 28664936, 28870260, 29127022, 29176936, 30197262, 30544423, 31159869, 31540976, 31605439, 31718573		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	31644329, 38415841, 40109215	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29118007		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28097534, 28473905, 28648302, 29222273, 29222312, 29698935, 30564891, 31581738		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18830259		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23888327		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30244487		★☆☆☆☆ Found in Text Mining only
Amyloidosis Primary Cutaneous	Amyloidosis	Pubtator	28504999	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28383817		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29922039		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	30372708		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	17064404, 20012629, 21161353, 21269571, 21791547, 23620109, 25005770, 25270018, 26232179		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	19096012, 32963041, 36613564	Associate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	33457080	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28798308, 29378617, 29576277, 31233838, 31464648		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	29700411	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	37055467	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	21927903, 23373967, 28825374		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29254497	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29489833, 35115362	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15188352, 17344889, 28245522, 28274252, 29191375		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15188352		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	15188352, 28245522, 37858677	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	32639111	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15188352, 28056736, 33296081, 37086046	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	27542294, 29790686	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29112182, 39662827	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15022318, 15188352, 15818672, 17064404, 17535987, 24742142, 27914594, 29112182, 29489833, 31061532, 32765511, 34654367, 36270740, 36640056, 36801909, 37457686, 39337675, 39586747	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23786396	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28150777	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28245522, 29790686		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27286421, 30765445		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36804777	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30009527, 34737749, 38183111	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35600045	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	27562213	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	28257599, 29935904, 31020718, 31762332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14617032, 15883854, 15912506, 15959535, 16227150, 17002900, 17203303, 17304234, 17468813, 17490403, 18041714, 20012629, 20178125, 21899511, 21927903, 21961966, 22039410, 22274654, 23373967, 27660198, 28214654, 28270509, 28843709, 28929192, 28990585, 29359792, 29609005, 29961175, 30182073, 30262031, 30386337, 30803202, 31464648, 31618754, 31723031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	15022318, 18041714, 20190142, 22039410, 27077771, 28056736, 29359792, 30325236, 31781109, 33193306, 34183838, 35979531, 36189300, 36308011, 37858677, 40243636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	LHGDN	19035512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	32616532, 36505471, 37930659	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35131574	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27694502, 27805626, 28115358, 28887367, 29118007, 29719019, 30824609, 31704289		★☆☆☆☆ Found in Text Mining only
Barth Syndrome	Barth syndrome	Pubtator	35418665	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22039410		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	28053236	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	32352498, 35967452, 37930138, 40414848	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29069302, 29133939, 29974196, 30457360, 30871066, 31270502, 31385407		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	30092832	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	25682964		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	27541170, 31556696	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33611636, 35857126	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37348508	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19028999, 30131293, 32017467, 33611636, 34596346, 34670827, 37272099, 38267913, 39593098	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28404866, 28535114, 28880903, 29391205, 30742122		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31424675	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21113674, 21487727, 23114578, 28488141, 28936553, 29016143, 29447919, 29707124, 29899663, 29921237, 29936058, 29983594, 30069490, 30122122, 30318965, 30393583, 30771277, 31075727, 31357142, 31516390, 31796506		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18294387, 26942414, 27117582, 27227944, 27912781, 28388539, 28537889, 29045526, 29063313, 29983831, 30069490, 30122122, 30318965, 30513096, 30519815, 30547271, 31081058, 31292534, 31591439, 31665365, 31839160, 32216835, 32266446, 32616706, 32681091, 32939056, 33112575, 33413541, 34185141, 34315723, 34319029, 34507558, 34542773, 34667028, 34741349, 34762599, 35121988, 35233733, 35614183, 35842661, 35894707, 36073303, 36088412, 36271406, 36388159, 36901916, 36951624, 37178414, 37377974, 37898851, 37963835, 38242720, 38267903, 39874011, 40108523, 40398661	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30759303	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35263601	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30519815	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	30765445		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31474998		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28033393	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	28974264	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30771277, 31623599, 33000216	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27453418, 28571578, 32373223, 35499071	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28463396, 32332015, 33457085, 34103354, 37194064, 37926435, 40275321	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29405663, 31844270		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	38101862	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	30085937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	38148043	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19058313, 24672661	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19826049, 21674477, 21876620, 21912640, 25427199, 25895129, 27034168, 28033288, 28624577, 29356308, 29375724, 29556041, 29666149, 29967316, 30506460, 30539869, 30719701, 30885723, 30939292, 31295151, 31337439, 31424675, 31558872, 31724091, 31731492, 31810126, 31927532, 32086577, 32587357, 32615319, 32863381, 32937024, 32945410, 33072070, 33118543, 33495920, 33993366, 34423049, 34689234, 34838121, 34839280, 34910956, 34925377, 34958112, 35236323, 35298067, 35316767, 35398623, 35592706, 35634309, 35812439, 35874743, 35902399, 36042180, 36062845, 36108710, 36118947, 36181013, 36464675, 36714595, 36830729, 37056769, 37058121, 37081394, 37131179, 37166013, 37173350, 37280393, 37377962, 37500263, 37584192, 37858067, 37928536, 38243049, 38421869, 38494878, 39321025, 39511687, 39712016, 39838375, 39867901, 40282408	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32203210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	33605014, 36263183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lewis Lung	Lewis lung carcinoma	Pubtator	35211760	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26729235	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	26965581, 28105368, 28807004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	24416729, 28793172, 30976104, 31399473, 32324435, 32687503, 34706521, 37851052, 38241371	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	37274772	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29069302, 29133939, 29974196, 30457360, 30871066, 31270502, 31385407		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26183759, 27534573, 28213003, 28288993, 28446615, 28679395, 28821924, 28980429, 29033936, 29049375, 29194117, 29675791, 29678530, 29683890, 29779430, 30125216, 30173128, 30244487, 30382588, 30564891, 30616523, 30965212, 31031765, 31156344, 31333652, 31348245, 31381177, 31478975, 31694838		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32275468, 33914317, 37868997	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25827621, 27329602, 27768182, 28602029, 32495519, 32636837, 34202040, 34335594, 35037417, 35718340, 36281157, 36306792, 37116489, 37449210, 40244011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20208540, 25583177, 26317902, 27292320, 27491898, 28832979, 29301960, 30131293, 30137025, 30564891, 30588196, 30972888, 30992011, 31064408, 31428993, 31646820, 31829518, 32277125, 32279409, 32396851, 32424467, 32493845, 33015999, 33389015, 33416945, 33537170, 33574053, 33605089, 33735492, 33797012, 33910834, 34002666, 34290908, 34446578, 34535962, 34563045, 34715028, 34953097, 36074149, 36479115, 36618968, 36734432, 36752726, 36849551, 36982415, 37221577, 37419794, 37653791, 37729872, 37943357, 38179741, 38599101, 40596969	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34607896	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25582496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26134222	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27879972, 29863979, 30108590, 30253973, 31141610, 31377718, 31605439, 31879171, 32139873, 32849590, 34716208, 34887858, 35095878, 35799269, 35813476, 35902966, 36032124, 36232331, 36281031, 36544782, 36759392, 37280525, 37338146, 37567864, 39477187	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31293069		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29742518		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25392179, 26625204, 27836206, 27986748, 28730785, 29337305, 29616115, 29707124, 30802149, 31600397		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	29221220		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	29386312, 34876047	Associate	★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	32020256	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28026044		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28026044	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34669781	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	34489963	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	14595408		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28609832, 33009409, 33460396, 33868266, 35017151, 35885987, 35930205, 35977003, 36912199, 39333574	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	29606147, 34607896, 39277735	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34099659, 35958603, 36505471	Inhibit	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	37122702	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	32581063, 34220824	Associate	★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	HPO_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27050970, 31322926, 31808707		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27050970, 31322926, 31808707		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30419854, 30885276, 31064408, 31200359, 31383016, 33239315, 34526987, 34603331, 35317832, 36159865, 36251029, 37247023, 37787790, 37973660, 38123132, 38547421, 39358645, 40589739	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31702638		★☆☆☆☆ Found in Text Mining only
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	32615319	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	37928536	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	25392179		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	25906748	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	25349132, 29051990	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	37277193	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 1p36 Deletion Syndrome	Chromosome 1p36 deletion syndrome	Pubtator	39482002	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25682964, 29118007, 31208150, 31496815, 31704289		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28062906		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28934595, 30349227, 31316109		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28122135		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	29632730		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28246107, 28945858, 29065967, 29369775, 31214189, 31704288		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	32208873, 34147519, 35427471	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37273534	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31358531, 31651174, 31692041, 31695411		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	29580042	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31061070	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31651174		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27198569, 27339628, 27341597, 28383777, 28739701, 29308317, 29471676, 29779430, 29848685, 30221062, 30334238, 30623416, 30723299, 30886395, 31358531, 31741761		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21179245, 26517354, 27198569, 27443512, 27552968, 27903500, 28403223, 28734759, 29580042, 30166615, 30172913, 30285662, 30670049, 30723299, 31038663, 31061070, 31078045, 31221124, 31429779, 31876399, 31921188, 32042474, 32111794, 32265897, 32393998, 32441316, 32468013, 33045001, 33264544, 33818637, 33849927, 34051513, 34083289, 34162716, 34349038, 34369992, 34797860, 34933913, 34975867, 35038827, 35181583, 35343934, 35762092, 35791694, 35930112, 35937946, 35958603, 36003387, 36119063, 36155259, 36295599, 36373163, 36389750, 36424637, 36479108, 36493599, 36528470, 36544760, 36599679, 36613564, 36656207, 36702949, 36773295, 36968142, 37002343, 37004094, 37059712, 37081776, 37172580, 37178411, 37239414, 37569431, 37607946, 37950153, 37986009, 38212126, 38302412, 38432446, 38583239, 39399495, 39456247, 40274385	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28596308, 34544358, 35185898, 36846928, 37269904, 39739032	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30081950	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	30723299, 31998307, 33140187, 34667028, 36338826	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33876323, 34247288, 35562849	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27977496, 29683413, 31770816		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28624577		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28419539		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	22274654, 30244487		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27059553, 27491898, 27540850, 28719055, 28807336, 28832979, 28945858, 29191375, 29301960, 29632730, 29922039, 29942309, 29977349, 29994900, 30464501, 30771277, 31343665, 31484656, 31549270, 31557787		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Band-Shaped	Corneal Dystrophy	BEFREE	31618754		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33761687	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	29509940	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	28484052	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15883854		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	23267208		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28247187, 29090522, 30880064, 31095042		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	35732550	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35732550	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28245522		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	22377759		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	22377759	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30943861		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30244487		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	37098880	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28211040		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36203592	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36513052	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus Neurogenic	Neurogenic diabetes insipidus	Pubtator	34424037	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28211040, 29955867, 31423559		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28418115, 28684632, 30650147, 37359544, 40244011	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25682896, 28418115, 28515940, 28877189, 30534571, 30814440, 31949260, 36169248, 37130628, 37498686, 37858677	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30650147	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27459386	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14617032, 15883854, 16227150, 16978382, 17130567, 17203303, 17570250, 18042085, 20518841, 25682896, 27761609, 28595520, 28877189, 29955867, 29995236, 30124874, 30524468, 31270583		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25682896, 30899528		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28557813, 30407284		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	30124874, 37359544	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	30407284		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	29254497	Inhibit	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	34102137, 35427471, 35586668, 39358463	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28403071, 29118007, 29435074, 29449276, 29598887, 30770362, 31704289		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	34488388	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30602320		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31699819	Associate	★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	32581063	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	36482425	Stimulate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29265516		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28829048		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	37644514	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	30124874	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	31813343		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26181000, 27159395, 29572003, 29572029		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27159395, 31370215, 31973911, 33001143, 33072070, 34124265, 34970268, 35242299, 35634444, 36199963, 36301137, 36509464, 36581331, 36805217, 37446260, 38238314, 39209049	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33968059	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30325236, 34656305	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30595667		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30765445		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27836206, 29616115, 31600397		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28848143		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27015293, 27577071, 31761900, 31882943, 32084010, 34067485, 36288460, 36466860, 37108474, 40587482	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28848143		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27120796, 27453418, 31761900, 34009732, 34625514, 35022193, 35036077, 35046943, 36359828, 36466860, 37038094, 37355621, 38244291	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35365175	Inhibit	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28868758, 29050367		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	29254497	Inhibit	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	36159840	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28419539, 28693161		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	32100077	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	39769220	Stimulate	★☆☆☆☆ Found in Text Mining only
Fasciitis	Fasciitis	BEFREE	30103042		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	28643391		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	33328484, 35022908, 35242133, 39358463	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	33856094	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30510858		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	31609250, 33180184, 35254400, 36996375	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	34798858	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	28662235		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30714229, 30762585	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	28188133, 29386072, 33376237, 34996890	Associate	★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	36875956	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28115719, 28314758		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31379838	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27370400, 28293764, 28447277, 28681455, 29016938, 29312296, 29317703, 31044422, 31567548, 31661771		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27807100, 28178682, 29302887, 29532035, 30189044, 30742119, 31467175, 31604779, 31907277, 32151286, 32316275, 32401608, 32860048, 33177572, 34493595, 35717510, 35718749, 37529045, 38268923, 39874011, 40016450	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27370400, 28293764, 28447277, 28681455, 28880903, 29016938, 29312296, 29317703, 31044422, 31567548, 31661771		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24375192, 26578623, 27370400, 28620836, 29396294, 31801484, 31819973, 32401608, 33140187, 34188042, 34728682, 35265072, 35481923, 36159811, 36311792, 37543576, 39740094, 40696074	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25971300, 27370400, 28681455, 30687086		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37330579	Inhibit	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	27370400, 34162346, 34876047	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28770269, 33121190	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	37075987	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28468799, 33868266, 34671352	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28270452, 28899972, 30622541, 31821459		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	19449188		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	33570446	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	17490403, 23373967, 28284988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	34494503	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	35619700	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35619700	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30078154		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	28974264, 34494503	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28721019, 30108590, 30464501, 31436392		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28408386, 29362132, 30108590, 30219915, 32699939, 33793576, 34755131, 35140722, 36395141	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31780628	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31851923	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	30801864	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	27269947	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27664133, 28062906, 29069302, 29118007, 29623180, 31245191		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30761875	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28257599	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24672661, 25895129, 27034168, 28033288, 28662185, 29739341, 30939292, 31464942, 33833369, 34910956, 36635631	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	35317832	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B Chronic	Hepatitis b	Pubtator	29666149, 30939292	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32937024	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	32994477	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	31781109	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	30723299		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	31190978		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18203952, 18594468		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18203952, 19096012, 25482239, 26678894, 27354476, 27451390, 28468799, 28893733, 29394125, 29949442, 30261066, 30514251, 30564891, 30783096, 31697809, 31816062, 32143684, 33113552, 33620088, 34584203, 34941990, 34980000, 35572591, 35833296, 36083129, 37642071, 40030000	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28097534, 28473905, 28648302, 29222273, 29222312, 29698935, 30564891, 31581738		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28418115	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30407284		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	36263036	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29739808		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	36482425	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28073132, 28945858, 29739808, 30124874		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	29254497, 30124874	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34484235, 37067635	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36445478, 36494419	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28463396, 28662235		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30257954		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37121574	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	18490780, 28074937, 30122122, 30759303, 31781109, 33421299, 33839757, 34349753, 34597347, 35769457, 37858677	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23291409, 28062906, 29345058, 30122122		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29359792, 30609280		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18851688, 19931185, 26113085, 29337305, 29987244		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	25399062	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19160029, 29065967, 29369775, 29910803		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26305224, 35848481	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30759303	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	29332341		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	29332341, 30969179	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	35427471	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	31190978		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31383016		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30085937		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29609005		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31743287		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31383967		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15352422		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30124874, 36275893, 39277735	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29762725		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	34356594	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	37348508	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30388926	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23283468	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20682852, 27708227, 29697355, 34103328, 36960055, 37457737, 37554265	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24038528, 30828801		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26219463, 28629373, 28693586, 29697355, 29908544, 30500073, 31291985, 31406210, 32020256, 32245463, 33057635, 33072070, 33495835, 33649342, 33758676, 33868266, 34129052, 34171128, 34663807, 35297213, 36653976, 37298237, 37457737, 37602517, 37759316, 38615511, 40225861, 40555045	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	38615511	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27565576, 28629373, 28643044, 30553527, 30675316, 30759726, 30828801		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	23888327		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	33495835	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29922039		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	27859479, 28134729, 28467522, 30027278, 30244487		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28574425		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	29288900		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	25906748, 34465597	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	31171504	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23041554, 25218665, 25895129, 26928313, 27034168, 27456947, 27501850, 27520877, 28147363, 28434648, 28624577, 28643391, 29113661, 29138342, 29258079, 29620156, 29666149, 29935904, 29967316, 29970455, 29995439, 30078052, 30102778, 30387047, 30980420, 31019861, 31171886, 31327798, 31337439, 31615069		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24672661	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29683413		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	18041714	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19739236, 25895129, 31464942, 32937024, 33833369, 34497613, 34910956, 38268921	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24672661	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36635631	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	37967215	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28169347	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32350591, 32557663, 35732550, 36439147, 37274772	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32652936	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	27599705, 34654367	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26014096, 26183035, 26183759, 27393506, 27447482, 27470969, 27502709, 28061450, 28289860, 28980429, 29132144, 29658848, 30165371, 30305853, 30986912, 31005568, 31086949, 31903110, 31923366, 32238919, 32396674, 32788875, 32793190, 33205076, 33479024, 33545799, 33793576, 33818637, 33956842, 34149722, 34324065, 34663810, 34767762, 34907653, 35273829, 35389889, 35586668, 36520426, 36561745, 37274772, 37378668, 37977237, 38177076, 39277735	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	29691251, 31086949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	34290408, 34437586, 36960400, 37979167	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15352422, 21952918		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15022318, 15188352, 15334473, 15818672, 15934088, 17064404, 17344889, 17535987, 19116915, 20178125, 21952918, 25098715, 25581113, 25938972, 26108738, 26782401, 27914594, 28056736, 31536480, 31781109, 32996897, 34101055, 34240405, 36189300, 38233074	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33777025	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15352422, 21952918		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11161781, 12402038, 14617032, 15022318, 15322919, 15334473, 15352422, 15883854, 15934088, 16227150, 17024563, 17064404, 17136123, 17228327, 17230193, 17343323, 17344889, 17535987, 17999073, 18401354, 18578969, 19074163, 19116915, 19220647, 20178125, 21952918, 25938972, 26108738, 26782401, 27286421, 27914594, 28274252, 28415570, 31551030, 31565862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12402038, 17344889, 17999073, 18401354, 18578969, 19035512, 19074163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	12402038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	14730631, 17228327, 19074163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	19074163, 28631301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	31536480	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	34081342	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15352422, 21952918		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	31437431		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26403784, 27453418, 27741514, 31492714, 34907653, 35388548, 36042498, 36359828, 37501393	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28693161		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30539869	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	36969238	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	22918164, 26850007, 27564404, 28356247, 28468799, 29998979, 30723112, 31184237, 31292525, 31556696, 33591648, 33876323, 35081690, 35572591, 35895386	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24038528, 25943068, 26049755, 27175027, 27564404, 27694502, 28670716, 29084057, 29128997, 29850620, 31118893, 31672704, 31704289		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31672704, 33335718	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20944673, 23297127, 25700246, 33133070, 35816682	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	30705877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	19224853		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	31704289		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28899972, 30930876		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	29084057, 30861172		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	32937024	Associate	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	30723299		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	29288900		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	28463396		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28442918, 28681455		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28721019, 30108590, 31436392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	28880903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21487727, 23114578, 25392179, 28488141, 28936553, 29016143, 29447919, 29707124, 29899663, 29921237, 29936058, 29983594, 30069490, 30122122, 30318965, 30393583, 30771277, 31357142, 31516390, 31796506		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26181000, 27159395, 29572029		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28848143, 31414718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28692048		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27801735, 30134343, 30405053, 31015307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28692048, 29552119, 30771277, 31424675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25765070, 26183759, 27534573, 28213003, 28288993, 28446615, 28679395, 28821924, 28980429, 29033936, 29049375, 29194117, 29675791, 29678530, 29683890, 29779430, 30125216, 30173128, 30244487, 30382588, 30564891, 30616523, 30693623, 30965212, 31031765, 31116807, 31156344, 31333652, 31348245, 31381177, 31478975, 31694838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28574425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	29742291		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25392179, 26625204, 27986748, 28730785, 29337305, 29707124, 30802149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28798308, 31694582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28461179, 28825923, 28893901, 29577933, 31182913, 31289580, 31567999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28648699		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28671728, 31285589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27943063, 30897754		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29069302, 29133939, 29974196, 30457360, 30871066, 31270502, 31385407		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23041554, 25392179, 26359984, 26401005, 26779629, 26901407, 26928313, 26943572, 27031235, 27196778, 27491050, 27541170, 27557786, 27565919, 27664133, 27693088, 27696202, 27749524, 27824586, 27846884, 27998967, 28025384, 28062906, 28114251, 28132417, 28147928, 28163164, 28258692, 28270509, 28281549, 28296676, 28321130, 28334399, 28402953, 28406723, 28409437, 28429196, 28442918, 28446615, 28446641, 28460462, 28487496, 28514441, 28537531, 28574425, 28635644, 28642997, 28652812, 28670716, 28679835, 28716069, 28753231, 28756224, 28798308, 28817405, 28825374, 28827658, 28864844, 28872489, 28880903, 28901560, 28903377, 28923212, 28929192, 28990585, 28993412, 29016143, 29026313, 29028121, 29033936, 29093678, 29114543, 29138342, 29147618, 29160310, 29163789, 29256113, 29273790, 29298869, 29309048, 29337305, 29343652, 29357948, 29385739, 29447919, 29472716, 29517083, 29519715, 29526974, 29532035, 29552135, 29556232, 29615718, 29616115, 29633300, 29654146, 29672601, 29674442, 29764856, 29779430, 29859207, 29872177, 29899663, 29922039, 29961183, 29963238, 29970158, 29980467, 29991874, 30068796, 30117062, 30149763, 30178256, 30183502, 30201790, 30244487, 30249505, 30250823, 30256271, 30268773, 30275195, 30377198, 30389797, 30407284, 30417020, 30466788, 30489484, 30521597, 30549256, 30605689, 30607140, 30622541, 30675316, 30723299, 30771277, 30786013, 30803026, 30807610, 30819829, 30874960, 30895168, 30899528, 30977778, 30991692, 31001256, 31022941, 31030093, 31058839, 31063806, 31069878, 31128201, 31159869, 31186768, 31196207, 31201647, 31212601, 31221124, 31232972, 31233838, 31253869, 31293882, 31317798, 31325788, 31343665, 31353229, 31386875, 31399419, 31402780, 31405171, 31428520, 31429085, 31436822, 31493351, 31532833, 31533865, 31546905, 31555274, 31599020, 31604533, 31639551, 31640203, 31661465, 31683962, 31709176, 31720814, 31733578, 31748880, 31761384, 31780710, 31796506		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27050970, 31322926, 31808707		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25392179, 31358531, 31651174, 31692041, 31695411		★☆☆☆☆ Found in Text Mining only
Malignant tumor of small intestine	Small intestine cancer	BEFREE	29332341		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18294387		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29016143, 29447919, 31796506		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23267208		★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	29378725	Associate	★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	20628145		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36825029	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19651643, 22850568, 24343228, 25720800, 25944800, 26763445, 26822383, 26940869, 26957557, 26966176, 27433843, 27650038, 27671167, 27837027, 27846054, 28026870, 28084337, 28324889, 28331615, 28397821, 28434031, 28476944, 28681063, 29320474, 29410200, 29546435, 29606147, 29970025, 29973670, 30131384, 30167863, 30175642, 30343532, 30355485, 30588196, 30718426, 30728070, 30804515, 30806748, 30824584, 30880120, 30925943, 31151362, 31171879, 31275310, 31300034, 31412814, 31484081, 31488153, 31506076, 31532537, 31625630, 31652661, 31677253, 31703593, 31792460, 31796647, 32036449, 32042196, 32120023, 32160899, 32162809, 32296058, 32312968, 32316408, 32350591, 32463489, 32939320, 33077770, 33128316, 33266349, 33294862, 33483342, 33495600, 33504219, 33506034, 33707233, 33872982, 33914706, 33922038, 33963011, 34028390, 34112666, 34177913, 34179721, 34290710, 34326162, 34654806, 34675925, 34737735, 34764492, 34795662, 34933966, 34950838, 34983745, 35087523, 35094125, 35192052, 35193932, 35247927, 35263570, 35280982, 35284940, 35302641, 35430568, 35550554, 35768432, 35793874, 35798536, 35874702, 36003398, 36052016, 36112545, 36169985, 36180872, 36232946, 36248850, 36273464, 36433984, 36450385, 36512357, 36573964, 36593066, 36614248, 36671443, 36719749, 37016119, 37037616, 37060248, 37072748, 37115668, 37229906, 37479483, 37507765, 37525015, 37660535, 37665297, 37808404, 37865395, 37887546, 37889972, 38082384, 38171116, 38243078, 38303608, 39237877, 39273294, 39354418, 39357979, 39684692, 39796063, 40023845, 40030000, 40056560, 40089202, 40133499, 40149458, 40222200, 40226614	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	20948441, 25392179, 25939491, 26048148, 26359984, 27662198, 27664133, 27824586, 27837027, 27910859, 28293764, 28363614, 28397821, 28546465, 28716069, 28719055, 28817445, 28945858, 28975219, 29024572, 29069302, 29090522, 29273790, 29337305, 29356789, 29633300, 29644214, 29843754, 29942309, 29974196, 30464501, 30489484, 30650959, 30664764, 30693623, 30771277, 30880064, 30892132, 30944610, 30965212, 31031765, 31063806, 31095042, 31128215, 31261257, 31321613, 31375512, 31446882, 31549270, 31552181, 31552251, 31557787, 31584451, 8579579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	21802280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	30124874, 30412106, 31727009, 33335718, 35107815, 36139377, 37880788, 39394099	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29185395, 31138334, 32457125, 33746582, 35116193, 36466837, 37662962, 38155221, 38279987	Associate	★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	29924748		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23930849, 31227506		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25609200	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29069302, 29742518, 30238195, 30287935, 30976104, 31343994, 31355203		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	30245692, 36669143, 36901697	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	34572136, 34987640, 36115921, 36669143, 36901697, 39966970	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25207460, 25939491, 27662198, 27977496, 28137295, 28214654, 28527652, 28817445, 29028121, 29033936, 29309059, 29468099, 29596939, 29746296, 29924748, 29961183, 29965858, 30124874, 30488824, 30539281, 30605822, 30617133, 30828569, 31036771, 31058839, 31261257, 31446882, 31523394, 31614774, 31625630, 31805700		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26261529		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	28074937	Associate	★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30385085, 32546692, 33777045	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	19468750		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27919908, 28461396, 28899972, 29435173, 30154111, 31620907		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	30761875, 33013907, 33303710, 33735518, 33890981, 34502204, 36355079, 36532059, 37122695	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22067141, 23373967, 27286421		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25360562, 28284331, 28767147, 31780628, 35383094, 36308011	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	18037500		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28234667, 30078154, 31374257, 31462152		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	39346912	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis, Generalized	Myasthenia Gravis	BEFREE	31497433		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	22377759, 22722467, 22918164, 30328260, 35194801	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	27565576, 28643044, 30675316		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20472834, 26966176, 27565576, 31406210, 33730109, 36003379, 36282797, 36810783	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28062906		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17002900		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	25385851	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30078154, 31022941		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	39333574	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30078154		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30862448		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35371068	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36804777	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	27696202, 29966370		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25361008, 28380458, 31138162, 32564263, 33492986, 33737344, 36438903, 37188668, 40083932	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30871579		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	37207653	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	34102137	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29742518		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20428207, 24764579, 25392179, 25539810, 25862322, 25939491, 26181000, 26359984, 26501438, 26541606, 26625204, 26833127, 26901407, 27117582, 27207108, 27346415, 27370400, 27491898, 27501850, 27520877, 27816392, 27837027, 27846884, 27894751, 27910859, 27919908, 28062906, 28073845, 28097229, 28099864, 28188185, 28197370, 28247187, 28265006, 28270499, 28288993, 28367063, 28368722, 28383777, 28389661, 28419539, 28421069, 28429196, 28432648, 28447277, 28463396, 28469081, 28483607, 28488141, 28539528, 28571578, 28681455, 28692048, 28768188, 28771750, 28783659, 28818019, 28819064, 28821924, 28832979, 28833116, 28846956, 28851662, 28861871, 28868758, 28870260, 28880903, 28899972, 28913723, 28922567, 28945858, 28947422, 28993412, 29016143, 29016555, 29050367, 29061772, 29072624, 29113661, 29122359, 29128997, 29143824, 29153625, 29160310, 29163789, 29167175, 29209560, 29222272, 29243049, 29277762, 29282323, 29288043, 29308317, 29311707, 29317703, 29336717, 29357948, 29398707, 29423114, 29434366, 29435074, 29447919, 29467336, 29511032, 29552119, 29596910, 29598887, 29614981, 29632730, 29674442, 29688262, 29706119, 29707124, 29721366, 29736798, 29742291, 29744662, 29764856, 29779430, 29843813, 29868471, 29922039, 29928359, 29949442, 29959712, 29962847, 30009527, 30026742, 30063143, 30068796, 30072391, 30108589, 30119080, 30158938, 30221062, 30244487, 30309915, 30311026, 30315719, 30318965, 30368118, 30375891, 30386337, 30457360, 30478423, 30523370, 30524891, 30555157, 30587557, 30616523, 30617136, 30648630, 30655605, 30668768, 30677447, 30711629, 30711957, 30719168, 30728081, 30755690, 30760527, 30802149, 30811474, 30819829, 30833751, 30867242, 30874960, 30886151, 30934955, 30969179, 30979816, 30987257, 31031765, 31048490, 31063806, 31075727, 31086342, 31086347, 31097342, 31128215, 31132649, 31151983, 31178388, 31180909, 31182913, 31205619, 31208698, 31233838, 31240875, 31275310, 31310752, 31312140, 31329159, 31337426, 31383016, 31383967, 31385405, 31414718, 31436822, 31540976, 31545446, 31546905, 31552181, 31567548, 31646070, 31646820, 31651174, 31661465, 31695411, 31697809, 31702638, 31703637, 31704289, 31709456, 31720814, 31748880, 31752991, 31796506, 31801817, 31804230, 31811434, 31814954, 31844270, 31848313		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30524891		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	17344889		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	29762725		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	29762725		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28270499, 31480495		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33239635, 35525858, 38125723, 39289439	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34218652, 39321200	Associate	★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	30078154		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29922039		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	35427471	Associate	★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Multiple sclerosis	Multiple Sclerosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25207460, 26134222, 26707383, 27297395, 27310809, 27485075, 27534574, 27540850, 27565919, 27664133, 27693088, 27816392, 28039262, 28073845, 28129007, 28214087, 28245875, 28276698, 28288993, 28293123, 28293764, 28318951, 28341875, 28446615, 28529902, 28549836, 28557813, 28613923, 28623122, 28739315, 28756224, 28818019, 28818609, 28822887, 28851662, 28881856, 28938671, 28945858, 28960263, 28975219, 29084031, 29095271, 29101058, 29147605, 29153898, 29158797, 29175386, 29209560, 29243049, 29269008, 29296533, 29317551, 29352857, 29378267, 29383038, 29499101, 29526752, 29572000, 29658848, 29764856, 29844002, 29915891, 29951305, 30026742, 30075155, 30158938, 30193240, 30249170, 30383701, 30390416, 30393621, 30405053, 30476576, 30489484, 30642449, 30642913, 30718052, 30725206, 30746209, 30746216, 30763730, 30765392, 30769852, 30775030, 30796165, 30797490, 30819828, 30819829, 30842182, 30867242, 30872362, 30885351, 30972766, 30977778, 30978241, 30996212, 31021392, 31030994, 31036771, 31060602, 31063806, 31118808, 31128201, 31159869, 31173242, 31174496, 31182061, 31206316, 31217824, 31239797, 31253869, 31285885, 31316109, 31333652, 31343665, 31348821, 31375454, 31381177, 31423946, 31449889, 31494258, 31497071, 31605795, 31619231, 31675272, 31686616, 31704288, 31721446, 31782989, 31786476, 31798692, 31810958		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31741761		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33197880	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36714595, 39765379	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	29742291		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31472246		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29924424, 32065479	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24866169, 27456063	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31442817		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26625204		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	32334621, 35046435	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25392179, 26625204, 27986748, 28730785, 29337305, 29707124, 29843813, 30802149		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17360651, 24297569, 26871470, 26937756, 27986748, 28730785, 29171986, 29843813, 31492714, 31980961, 32193378, 32446718, 33189611, 33492447, 34075161, 34322886, 34656305, 34768993, 34946254, 35026984, 35289120, 35545291, 35552618, 35838045, 36275748, 36561981, 36726489, 37179293, 37339172, 37759229, 37791232, 37868825, 38095409, 39608974	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28798308, 31694582		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28798308, 28912094, 29576277, 31464648, 31694582		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25795132, 27777771, 28241889, 28798308, 31440238, 32051287, 32114502, 32643277, 34459462, 36224560, 36341552, 37116489, 37127565, 37130628, 37339979, 38012210	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	31851923	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	29509940		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29128181		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	22322668, 38193541	Associate	★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	36130508	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	35131574	Stimulate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	23409198	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33552685	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27910859		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	19449188		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31474998	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	30727791		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34502071	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	34102137	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31497016	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37768208	Stimulate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	32652004, 34745002, 36161330	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	30856277, 31639551		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	29609005		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33521133	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	25906748	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31399482		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	18041714		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29067721, 29152083, 29548055, 31292525		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28461179, 28825923, 28893901, 29577933, 31182913, 31289580, 31567999		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26993768	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26260996, 27429197, 28223102, 28460462, 31431617, 31545446, 32453797, 32552802, 33215787, 33402116, 33569050, 33899001, 33934205, 34417325, 34445612, 34737749, 35772050, 36522531, 37067635, 37223924, 38087324, 39265220	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	26048148		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21166663, 26048148		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	39769220	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22829758, 26517304, 35732550, 35991707	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28934595, 30349227	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25536276	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30257954, 30315241		★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	24269013		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30807610		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27801735, 30405053		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27491898, 27540850, 28719055, 28807336, 28945858, 29191375, 29632730, 29922039, 29942309, 29977349, 29994900, 30134343, 30464501, 30771277, 31343665, 31484656, 31549270, 31557787, 31646820		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	31406266		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	31406266		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32100078	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31704149, 35371041	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15022318, 15188352, 15818672, 15883854, 15959535, 16227150, 17064404, 17468813, 17535987, 17597384, 21961966, 23373967, 27914594, 28245522, 28572054, 28791012, 28858091, 29626269, 29961175, 30810221		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15022318		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	25073001, 29234685, 29898781, 37863732	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27564547, 30027278, 31437317		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24349382, 25805798, 25906748, 28463396, 30963193, 32792357, 33762319, 34218652, 34817950, 35448937, 35986756, 37661910	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28442918, 28463396, 28688724, 29220291		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27259563	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31394407	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	31171504	Associate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28832979		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	29914578, 31755433	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28188185, 31788079		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23073310	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	29928359		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26183035, 27459386, 30747773, 31484735, 35732550, 37724530, 39684323, 40398661	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24463978, 26063974, 27993215, 28397730, 28888058, 29049359, 29225343, 29345058, 29661350, 30159323, 30291379, 30747773, 31576433		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	22918164, 32760603, 34570200, 35758515	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30328260	Stimulate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	30012209		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12528117, 24574234, 31412888, 32963045	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35020842	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36482425	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31163235		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26957557	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	36825932	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases Vascular	Skin disease	Pubtator	26957557	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29304116		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	27879972	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34768806	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30487198, 30656807		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27354668, 27520630, 29535912, 29776963, 30819828, 31381177, 31549270		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28586388, 34006632, 34228218, 34329846, 35586668	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34907653	Inhibit	★☆☆☆☆ Found in Text Mining only
Small intestine carcinoma	Small Intestinal Carcinoma	BEFREE	29332341		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	17064404	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26134222, 28664936, 31605439		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29892935, 30796203, 31612917		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21442435, 23288508, 27777979, 28460011, 28487502, 28756882, 28947422, 28948509, 29345283, 29416107, 29440293, 29467336, 30576970, 30767115, 31379843, 31527697, 31674884, 32124416, 32183719, 32238919, 32381551, 32546692, 32697949, 32943444, 33513276, 33995377, 34187851, 34657509, 34668665, 34737735, 34755131, 34755137, 34823553, 34862248, 34965944, 35225458, 35281069, 35768785, 35794182, 35941227, 36224603, 36597662, 37057033, 37366893, 37666053, 37713790, 38159908, 39549431	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33138288, 38066522	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30808583, 30815803		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30811629		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28382569, 28487502, 28771750, 29355614, 29467336, 29548299, 29742291, 29756633, 30108590, 30319973, 30619746, 30895168, 30987257, 31527697, 31562203, 31593831, 31762164		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28947422		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28463396, 28662235		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28671728, 31285589		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	40275321	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27147580, 27241062, 27741514, 28056089, 28207501, 29673110, 30018250, 30508306, 30911684, 31236579, 31285589, 31519868, 31722674, 32089413, 32131763, 32203221, 32373223, 32913031, 32943749, 33101772, 33126883, 33404124, 33457080, 33460964, 33575321, 33579944, 33611641, 33769705, 33954872, 34106609, 34235004, 34305941, 34367732, 34434611, 34552824, 34767045, 35241494, 35382776, 35401534, 35734348, 35741779, 35801342, 35811317, 36353623, 36369379, 36614254, 36640052, 36737759, 36761750, 36788224, 36912199, 37036308, 37277193, 37343324, 37781029, 37889437, 37970473, 37993847, 38050219, 38050871, 38244710, 38307189, 39244216, 39272096, 39806853, 40275321	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28463396		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29191375		★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	29609005		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29245183		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	19095563		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29143824, 30803026, 31029646, 31330525, 31487202		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	22274654		★☆☆☆☆ Found in Text Mining only
Teratoma Ovarian	Ovarian teratoma	Pubtator	30412106	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26598537	Associate	★☆☆☆☆ Found in Text Mining only
Thoracic Neoplasms	Thoracic neoplasm	Pubtator	38124509	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	30600651, 31639039		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29927883		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28974264, 31159823, 32348468, 34465342, 36211409, 36420264, 36518249, 38457034	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27943063, 30897754		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31637475, 34397868, 37122752	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	39355355	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27943063, 30897754		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35388548, 37501393	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	30782080		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	32323619	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34099659, 34494503, 36518249	Associate	★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	31111437		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	LHGDN	18056444		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	28400429	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25392179, 28936553, 29291717, 29336717, 29424936, 29438695, 30728081, 31075727, 31086347, 31614877, 31723167, 31752991, 31796994		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26317899, 27138582, 27912781, 29336717, 29615063, 29996881, 30294328, 30728081, 30929569, 31836816, 32019858, 32709714, 33717059, 33918859, 34185141, 34580291, 34583980, 35337339, 35748713, 36161312, 36880837, 37390206, 37671167, 37729362, 37767092, 37924153, 38267903, 39214650, 39780116, 40613791	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31437431		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	26028255, 28596308, 31998307, 33215787, 34427115, 34667028, 34975873, 35352512, 36030556, 36301137, 36522531, 37847338, 38022513, 39530558	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	29472312, 31675272		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19160029		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24606459, 29312460, 30009527, 30400941, 30666091, 31174611, 32497499, 33064988, 33356494, 33793576, 34530089, 35029177, 35209909, 35227680, 35314433, 35768833, 35972693, 36275893, 36474424, 37151354, 37379131, 37705121, 37955535, 38015710, 39867879, 40630945	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29153625, 30182073, 30457360, 30719168, 31030123, 31058839		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	23101188		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	29472312		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23521696, 29400020, 34290992	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27050970, 27721577, 28075442, 29145543, 31586491, 32917410, 32964058, 33424844, 34011535, 34076351, 34848831, 35154907, 36042498, 37469254, 37938121, 38193091, 38215117, 39201462	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31274701, 37818745	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	24658839, 29472312, 36104728	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18296654, 29185395, 29581543, 29760383, 30787124, 33072070, 33262254, 34782661, 39349498	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28648699, 30607140		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30311026, 31618754		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	19234630		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	19234630	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	35930205	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22274654, 29923081, 30873951		★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	29923081		★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	36601880	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26957557, 31532537	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28094061, 28945858, 31046170		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33711672	Stimulate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28094061, 28945858, 31046170		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30981637	Associate	★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	29282323		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	36232946	Associate	★☆☆☆☆ Found in Text Mining only