Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51312
Gene name	Solute carrier family 25 member 37
Gene symbol	SLC25A37
Synonyms (NCBI Gene)	HT015MFRNMFRN1MSCMSCPPRO1278PRO1584PRO2217
Chromosome	8
Chromosome location	8p21.2
Summary	SLC25A37 is a solute carrier localized in the mitochondrial inner membrane. It functions as an essential iron importer for the synthesis of mitochondrial heme and iron-sulfur clusters (summary by Chen et al., 2009 [PubMed 19805291]).[supplied by OMIM, Jan

199

Show/Hide all (199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025959	hsa-miR-7-5p	Sequencing	20371350
MIRT050876	hsa-miR-17-5p	CLASH	23622248
MIRT676302	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT676301	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT676300	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT676299	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT676298	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT676297	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT676296	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT676295	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT676294	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT676293	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT676292	hsa-miR-1976	HITS-CLIP	23824327
MIRT676291	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT676290	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT676289	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676288	hsa-miR-5095	HITS-CLIP	23824327
MIRT676287	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT676286	hsa-miR-4279	HITS-CLIP	23824327
MIRT676285	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT505627	hsa-miR-3617-5p	PAR-CLIP	23446348
MIRT505626	hsa-miR-641	PAR-CLIP	23446348
MIRT505625	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT505624	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT505623	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT505622	hsa-miR-4476	PAR-CLIP	23446348
MIRT505621	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT505620	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT505619	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT505618	hsa-miR-765	PAR-CLIP	23446348
MIRT505617	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT505616	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT505615	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT505614	hsa-miR-3144-5p	PAR-CLIP	23446348
MIRT505613	hsa-miR-3191-3p	PAR-CLIP	23446348
MIRT505612	hsa-miR-4652-5p	PAR-CLIP	23446348
MIRT505611	hsa-miR-636	PAR-CLIP	23446348
MIRT505610	hsa-miR-6505-5p	PAR-CLIP	23446348
MIRT505609	hsa-miR-4443	PAR-CLIP	23446348
MIRT172810	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT505608	hsa-miR-6810-5p	PAR-CLIP	23446348
MIRT172788	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT172789	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT172791	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT172794	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	27418678
MIRT739121	hsa-miR-513a-3p	HITS-CLIP	27418678
MIRT739121	hsa-miR-513a-3p	HITS-CLIP	27418678
MIRT739121	hsa-miR-513a-3p	HITS-CLIP	27418678
MIRT739121	hsa-miR-513a-3p	HITS-CLIP	27418678
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	28735896
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	28735896
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	28735896
MIRT739575	hsa-miR-4676-3p	HITS-CLIP	28735896
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	28735896
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	28735896
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	28735896
MIRT739577	hsa-miR-4693-5p	HITS-CLIP	28735896
MIRT739121	hsa-miR-513a-3p	HITS-CLIP	28735896
MIRT676302	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT676301	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT676300	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT676299	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT676298	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT676297	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT676296	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT676295	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT676294	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT676293	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT676292	hsa-miR-1976	HITS-CLIP	23824327
MIRT676291	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT676290	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT676289	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676288	hsa-miR-5095	HITS-CLIP	23824327
MIRT676287	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT676286	hsa-miR-4279	HITS-CLIP	23824327
MIRT676285	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT505627	hsa-miR-3617-5p	PAR-CLIP	23446348
MIRT505626	hsa-miR-641	PAR-CLIP	23446348
MIRT505625	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT505624	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT505623	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT505622	hsa-miR-4476	PAR-CLIP	23446348
MIRT505621	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT505620	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT505619	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT505618	hsa-miR-765	PAR-CLIP	23446348
MIRT505617	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT505616	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT505615	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT505614	hsa-miR-3144-5p	PAR-CLIP	23446348
MIRT505613	hsa-miR-3191-3p	PAR-CLIP	23446348
MIRT505612	hsa-miR-4652-5p	PAR-CLIP	23446348
MIRT505611	hsa-miR-636	PAR-CLIP	23446348
MIRT505610	hsa-miR-6505-5p	PAR-CLIP	23446348
MIRT505609	hsa-miR-4443	PAR-CLIP	23446348
MIRT172810	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT505608	hsa-miR-6810-5p	PAR-CLIP	23446348
MIRT1356598	hsa-miR-124	CLIP-seq
MIRT1356599	hsa-miR-1256	CLIP-seq
MIRT1356600	hsa-miR-1297	CLIP-seq
MIRT1356601	hsa-miR-1470	CLIP-seq
MIRT1356602	hsa-miR-181a	CLIP-seq
MIRT1356603	hsa-miR-181b	CLIP-seq
MIRT1356604	hsa-miR-181c	CLIP-seq
MIRT1356605	hsa-miR-181d	CLIP-seq
MIRT1356606	hsa-miR-2110	CLIP-seq
MIRT1356607	hsa-miR-22	CLIP-seq
MIRT1356608	hsa-miR-2682	CLIP-seq
MIRT1356609	hsa-miR-26a	CLIP-seq
MIRT1356610	hsa-miR-26b	CLIP-seq
MIRT1356611	hsa-miR-3065-3p	CLIP-seq
MIRT1356612	hsa-miR-3127-3p	CLIP-seq
MIRT1356613	hsa-miR-3150a-3p	CLIP-seq
MIRT1356614	hsa-miR-3175	CLIP-seq
MIRT1356615	hsa-miR-3183	CLIP-seq
MIRT1356616	hsa-miR-3184	CLIP-seq
MIRT1356617	hsa-miR-3192	CLIP-seq
MIRT1356618	hsa-miR-326	CLIP-seq
MIRT1356619	hsa-miR-330-5p	CLIP-seq
MIRT1356620	hsa-miR-3613-3p	CLIP-seq
MIRT1356621	hsa-miR-3620	CLIP-seq
MIRT1356622	hsa-miR-3691-3p	CLIP-seq
MIRT1356623	hsa-miR-3714	CLIP-seq
MIRT1356624	hsa-miR-3910	CLIP-seq
MIRT1356625	hsa-miR-423-5p	CLIP-seq
MIRT1356626	hsa-miR-4262	CLIP-seq
MIRT1356627	hsa-miR-4314	CLIP-seq
MIRT1356628	hsa-miR-4420	CLIP-seq
MIRT1356629	hsa-miR-4465	CLIP-seq
MIRT1356630	hsa-miR-4489	CLIP-seq
MIRT1356631	hsa-miR-449c	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT1356632	hsa-miR-4521	CLIP-seq
MIRT1356633	hsa-miR-4646-5p	CLIP-seq
MIRT1356634	hsa-miR-4659a-3p	CLIP-seq
MIRT1356635	hsa-miR-4659b-3p	CLIP-seq
MIRT1356636	hsa-miR-4667-3p	CLIP-seq
MIRT1356637	hsa-miR-4723-3p	CLIP-seq
MIRT1356638	hsa-miR-4738-3p	CLIP-seq
MIRT1356639	hsa-miR-506	CLIP-seq
MIRT1356640	hsa-miR-516b	CLIP-seq
MIRT1356641	hsa-miR-642a	CLIP-seq
MIRT1356642	hsa-miR-720	CLIP-seq
MIRT1356643	hsa-miR-939	CLIP-seq
MIRT1356644	hsa-miR-940	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT1356602	hsa-miR-181a	CLIP-seq
MIRT1356603	hsa-miR-181b	CLIP-seq
MIRT1356604	hsa-miR-181c	CLIP-seq
MIRT1356605	hsa-miR-181d	CLIP-seq
MIRT1356620	hsa-miR-3613-3p	CLIP-seq
MIRT1356626	hsa-miR-4262	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT2105662	hsa-miR-4719	CLIP-seq
MIRT1356602	hsa-miR-181a	CLIP-seq
MIRT1356603	hsa-miR-181b	CLIP-seq
MIRT1356604	hsa-miR-181c	CLIP-seq
MIRT1356605	hsa-miR-181d	CLIP-seq
MIRT1356622	hsa-miR-3691-3p	CLIP-seq
MIRT1356626	hsa-miR-4262	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT2105662	hsa-miR-4719	CLIP-seq
MIRT1356602	hsa-miR-181a	CLIP-seq
MIRT1356603	hsa-miR-181b	CLIP-seq
MIRT1356604	hsa-miR-181c	CLIP-seq
MIRT1356605	hsa-miR-181d	CLIP-seq
MIRT1356607	hsa-miR-22	CLIP-seq
MIRT1356616	hsa-miR-3184	CLIP-seq
MIRT1356625	hsa-miR-423-5p	CLIP-seq
MIRT1356626	hsa-miR-4262	CLIP-seq
MIRT1356630	hsa-miR-4489	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT1356638	hsa-miR-4738-3p	CLIP-seq
MIRT1356640	hsa-miR-516b	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT739576	hsa-miR-452	CLIP-seq
MIRT2624232	hsa-miR-3667-3p	CLIP-seq
MIRT1356622	hsa-miR-3691-3p	CLIP-seq
MIRT2624233	hsa-miR-4421	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005381	Function	Iron ion transmembrane transporter activity	IDA	35513392
GO:0005381	Function	Iron ion transmembrane transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0015093	Function	Ferrous iron transmembrane transporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	IEA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	ISS
GO:0048250	Process	Iron import into the mitochondrion	IBA
GO:0048250	Process	Iron import into the mitochondrion	IEA
GO:0048250	Process	Iron import into the mitochondrion	IMP	35513392

MIM	HGNC	e!Ensembl
610387	29786	ENSG00000147454

Q9NYZ2

Protein name

Mitoferrin-1 (Mitochondrial iron transporter 1) (Mitochondrial solute carrier protein) (Solute carrier family 25 member 37)

Protein function

Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	41 → 136	Mitochondrial carrier protein	Family
PF00153	Mito_carr	139 → 230	Mitochondrial carrier protein	Family
PF00153	Mito_carr	230 → 331	Mitochondrial carrier protein	Family

Sequence

MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH
SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM
YFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS
AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY

Sequence length

338

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVIUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (182)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24400095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23391335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29866045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24400095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16369535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult-onset citrullinemia type 2	Citrullinemia	BEFREE	12111366, 12602510		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	21168381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	28699252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30586546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22472631, 30048006, 30479062, 31054608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	27082501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	22253756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Refractory	Refractory anemia	Pubtator	25955609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26413886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28864290, 31583844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25854712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30889317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29412789, 29921387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29793557, 30852246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31187597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31826604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21703839, 26547710, 28405609, 30118778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	30140403		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18368067		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29767235, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	31514982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	19687708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22644871		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22533467, 30160360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	18368067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30670911, 38287833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28523512, 30393160, 30736829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37304236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22172102, 24609542, 26179662, 30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29553539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27681821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	28667374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29636880, 29637820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24447306, 28761170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24400095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19929986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	25498831, 28390197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28911970, 29156550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	36589413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29797577, 30054522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25740061, 30220706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29384527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28112873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	22696050, 29432491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25860916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27812180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33686958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23625284, 29892282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	24436441, 29284199, 30683144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27194025, 28279188, 29328479, 29428675, 29728632, 29905361, 30734541, 30964245, 31443940, 31456015, 31760502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30628649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31036853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31036853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25818803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25818803, 28447876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30074271, 31281533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29778021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31023998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	22190446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31036853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28374921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29486902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	21627978, 30391163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29953975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29989666, 30515693		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29989666, 30515693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	27750112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28181132, 29861737, 30114694, 30635047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	28418867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	27862217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19074414, 19765892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19074414, 19765892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21261460, 22525671, 24436439, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30630121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	29653141, 31786163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25860916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22696050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	26857230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12588891, 20519630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16369535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29481801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	19187226	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20957739, 28332363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28565787, 30257725, 31541181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28919171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	27236577, 28565834, 30823385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28397068, 30463591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28842625, 29892282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29137981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	31281533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	24854990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24447306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29066510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26830766, 29102933, 29355065, 30155487, 30880031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19929986		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24400095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26590574, 27833093, 27872094, 29207054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28478399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limbal stem cell deficiency	Limbal stem cell deficiency	BEFREE	28758321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24451114, 25619723, 28903370, 29346427, 31781559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	31212896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	22844472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31219208, 31303498, 31400854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29090347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28911970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31191681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21088137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	18368067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	30561580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	28667374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24436439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22644871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28523512, 30393160, 30736829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22172102, 24609542, 26179662, 30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30100261, 30742129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23792449, 26095189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26091251, 26934326, 30379370, 31675985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17616689, 20435406, 22688186, 23034983, 25013366, 26021486, 26934326, 29346427, 29410778, 29866045, 30305729, 30379370, 31023384, 31197361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25740061, 30220706		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18671316, 27813493, 28294393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30333196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23736306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	30575819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	39337531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29563136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23454749, 25758779, 26976208, 27641212, 28273548, 28580305, 28759800, 29563136, 29724992, 30408155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22568986, 23826999, 27705922, 30807806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	19460366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28405609		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24854990, 25428262, 30575819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23299311, 28772207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17445769, 28662151, 29044850, 30611986, 31296837, 31547872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29661576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17616689, 18671316, 19047138, 19687708, 19844197, 20388793, 20435406, 21261460, 21439934, 21608083, 21792181, 22172102, 22525671, 25758779, 26934326 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25774696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31054608, 31707461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	28775147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30628649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	30429460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23488598, 27762728, 29766824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	31737079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	27677799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28255275, 30646958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23927731, 28578832, 29853911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28053020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29546669, 30683144, 31311554		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22172102, 24609542, 26179662, 26755648, 30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30100261, 30742129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28115014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20544825, 23633297, 30483752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29731776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30523787, 31611920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29546669, 31311554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23792449, 26095189		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23047795, 35715447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	30391163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	27012815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28385811, 29673394, 29722562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	25955609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27812180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	30311259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29731776, 29921387, 30112846, 31722720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35863510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	24138016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30579092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28090688, 28391364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	28521479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	31722720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31534531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22688186, 26091251, 26934326, 30379370, 31675985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23413114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	26882313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29338384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29338384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28912898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34617815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC25A37 (solute carrier family 25 member 37)