Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51310
Gene name	Solute carrier family 22 member 17
Gene symbol	SLC22A17
Synonyms (NCBI Gene)	24p3RBOCTBOITNGALRNGALR2NGALR3hBOIT
Chromosome	14
Chromosome location	14q11.2

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT675003	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT675002	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT675003	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT675002	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT1354387	hsa-miR-1257	CLIP-seq
MIRT1354388	hsa-miR-15a	CLIP-seq
MIRT1354389	hsa-miR-15b	CLIP-seq
MIRT1354390	hsa-miR-16	CLIP-seq
MIRT1354391	hsa-miR-195	CLIP-seq
MIRT1354392	hsa-miR-330-3p	CLIP-seq
MIRT1354393	hsa-miR-3926	CLIP-seq
MIRT1354394	hsa-miR-424	CLIP-seq
MIRT1354395	hsa-miR-497	CLIP-seq
MIRT1354396	hsa-miR-518a-5p	CLIP-seq
MIRT1354397	hsa-miR-527	CLIP-seq
MIRT1354398	hsa-miR-548s	CLIP-seq
MIRT2329468	hsa-miR-511	CLIP-seq
MIRT2623747	hsa-miR-1285	CLIP-seq
MIRT2623748	hsa-miR-1293	CLIP-seq
MIRT2623749	hsa-miR-147	CLIP-seq
MIRT2623750	hsa-miR-2278	CLIP-seq
MIRT2623751	hsa-miR-3064-3p	CLIP-seq
MIRT2623752	hsa-miR-3162-3p	CLIP-seq
MIRT2623753	hsa-miR-3165	CLIP-seq
MIRT2623754	hsa-miR-3173-5p	CLIP-seq
MIRT2623755	hsa-miR-3187-5p	CLIP-seq
MIRT2623756	hsa-miR-3194-5p	CLIP-seq
MIRT2623757	hsa-miR-3672	CLIP-seq
MIRT2623758	hsa-miR-3691-5p	CLIP-seq
MIRT2623759	hsa-miR-378g	CLIP-seq
MIRT2623760	hsa-miR-3911	CLIP-seq
MIRT2623761	hsa-miR-4258	CLIP-seq
MIRT2623762	hsa-miR-4264	CLIP-seq
MIRT2623763	hsa-miR-4265	CLIP-seq
MIRT2623764	hsa-miR-4296	CLIP-seq
MIRT2623765	hsa-miR-4297	CLIP-seq
MIRT2623766	hsa-miR-4314	CLIP-seq
MIRT2623767	hsa-miR-4322	CLIP-seq
MIRT2623768	hsa-miR-4417	CLIP-seq
MIRT2623769	hsa-miR-4483	CLIP-seq
MIRT2623770	hsa-miR-4486	CLIP-seq
MIRT2623771	hsa-miR-451b	CLIP-seq
MIRT2623772	hsa-miR-4640-5p	CLIP-seq
MIRT2623773	hsa-miR-4652-3p	CLIP-seq
MIRT2623774	hsa-miR-4715-3p	CLIP-seq
MIRT2623775	hsa-miR-4726-5p	CLIP-seq
MIRT2623776	hsa-miR-4764-5p	CLIP-seq
MIRT2623777	hsa-miR-4778-3p	CLIP-seq
MIRT2623778	hsa-miR-494	CLIP-seq
MIRT2623779	hsa-miR-510	CLIP-seq
MIRT2623780	hsa-miR-512-5p	CLIP-seq
MIRT2623781	hsa-miR-612	CLIP-seq
MIRT2623782	hsa-miR-622	CLIP-seq
MIRT2623783	hsa-miR-644	CLIP-seq
MIRT2623747	hsa-miR-1285	CLIP-seq
MIRT2623751	hsa-miR-3064-3p	CLIP-seq
MIRT2623752	hsa-miR-3162-3p	CLIP-seq
MIRT2623754	hsa-miR-3173-5p	CLIP-seq
MIRT2623755	hsa-miR-3187-5p	CLIP-seq
MIRT2623757	hsa-miR-3672	CLIP-seq
MIRT2623759	hsa-miR-378g	CLIP-seq
MIRT2623762	hsa-miR-4264	CLIP-seq
MIRT2623765	hsa-miR-4297	CLIP-seq
MIRT2623766	hsa-miR-4314	CLIP-seq
MIRT2623770	hsa-miR-4486	CLIP-seq
MIRT2623774	hsa-miR-4715-3p	CLIP-seq
MIRT2623777	hsa-miR-4778-3p	CLIP-seq
MIRT2623779	hsa-miR-510	CLIP-seq
MIRT2623780	hsa-miR-512-5p	CLIP-seq
MIRT2623781	hsa-miR-612	CLIP-seq
MIRT2623782	hsa-miR-622	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005773	Component	Vacuole	IEA
GO:0005774	Component	Vacuolar membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	17253959
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	TAS
GO:0015891	Process	Siderophore transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0022857	Function	Transmembrane transporter activity	TAS
GO:0031090	Component	Organelle membrane	IDA	17253959
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
611461	23095	ENSG00000092096

Q8WUG5

Protein name

Solute carrier family 22 member 17 (24p3 receptor) (24p3R) (Brain-type organic cation transporter) (Lipocalin-2 receptor) (Neutrophil gelatinase-associated lipocalin receptor) (NgalR)

Protein function

Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	89 → 507	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain.

Sequence

MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASRVATSTDPSCS
GFAPPDFNHCLKDWDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGY
PADRFGRRGIVLLTLGLVGPCGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRLELC
DPTQRLRVALAGELVGVGGHFLFLGLALVSKDWRFLQRMITAPCILFLFYGWPGLFLESA
RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
YRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVD
RFGRRGILLLSMTLTGIASLVLLGLWDCEHPIFPTVWAQQGNPNRDLNEAAITTFSVLGL
FSSQAAAILSTLLAAEVIPTTVRGRGLGLIMALGALGGLSGPAQRLHMGHGAFLQHVVLA
ACALLCILSIMLLPETKRKLLPEVLRDGELCRRPSLLRQPPPTRCDHVPLLATPNPAL

Sequence length

538

Interactions

View interactions

	Reactome
			Iron uptake and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28249896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19047093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30138675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17253959, 19047093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21184133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22728279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	GWASDB_DG	21642993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22728279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	39358721	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19047093, 21950422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21184133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21950422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19047093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32164594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24295734		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC22A17 (solute carrier family 22 member 17)