ARMCX1 (armadillo repeat containing X-linked 1)

Gene

• Entrez ID: 51309
• Gene name: Armadillo repeat containing X-linked 1
• Gene symbol: ARMCX1
• Synonyms (NCBI Gene): ALEX1, GASP7
• Chromosome: X
• Chromosome location: Xq22.1
• Summary: This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are invo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT799312	hsa-miR-4528	CLIP-seq
MIRT799313	hsa-miR-4720-3p	CLIP-seq
MIRT799314	hsa-miR-4804-3p	CLIP-seq
MIRT1936010	hsa-miR-3662	CLIP-seq
MIRT799313	hsa-miR-4720-3p	CLIP-seq
MIRT799314	hsa-miR-4804-3p	CLIP-seq
MIRT1936011	hsa-miR-522	CLIP-seq
MIRT799312	hsa-miR-4528	CLIP-seq
MIRT799313	hsa-miR-4720-3p	CLIP-seq
MIRT799314	hsa-miR-4804-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA

Other IDs

• MIM: 300362
• HGNC: 18073
• e!Ensembl: ENSG00000126947

Protein

• UniProt ID: Q9P291
• Protein name: Armadillo repeat-containing X-linked protein 1 (ARM protein lost in epithelial cancers on chromosome X 1) (Protein ALEX1)
• Protein function: Regulates mitochondrial transport during axon regeneration. Increases the proportion of motile mitochondria by recruiting stationary mitochondria into the motile pool. Enhances mitochondria movement and neurite growth in both adult axons and emb
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04826	Arm_2	194 → 447	Armadillo-like	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels ovary, heart, testis, prostate, brain, spleen and colon. Expressed at very low levels in liver and thymus. Not expressed in peripheral blood leukocytes. Not or reduced expressed in lung, prostate, colon, pancre
• Sequence:

  MGRTREAGCVAAGVVIGAGACYCVYRLAWGRDENEKIWDEDEESTDTSEIGVETVKGAKT
  NAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQAS
  AKAGKGARVGTISGNRTLAPSLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRA
  PATTWPVRRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQ
  NAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDTMVCRL
  DSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQIMKLIINFTENPAM
  TRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSRKEFSRSSLFFL
  FKESGVCVKKIKALANHNDLVVKVKVLKVLTKL

• Sequence length: 453

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	25921134		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25921134	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22494058	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26464700	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11162520		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26464700	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22494058		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22494058		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22494058	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25921134		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11162520		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28315004		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25921134, 28315004		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28315004		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	36726491	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32685472, 36726491	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26464700	Associate	★☆☆☆☆ Found in Text Mining only