Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51299
Gene name	Neuritin 1
Gene symbol	NRN1
Synonyms (NCBI Gene)	NRNdJ380B8.2
Chromosome	6
Chromosome location	6p25.1
Summary	This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by n

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028913	hsa-miR-26b-5p	Microarray	19088304
MIRT050310	hsa-miR-25-3p	CLASH	23622248
MIRT049996	hsa-miR-28-5p	CLASH	23622248
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT1194313	hsa-miR-103a	CLIP-seq
MIRT1194314	hsa-miR-107	CLIP-seq
MIRT1194315	hsa-miR-129-5p	CLIP-seq
MIRT1194316	hsa-miR-15a	CLIP-seq
MIRT1194317	hsa-miR-15b	CLIP-seq
MIRT1194318	hsa-miR-16	CLIP-seq
MIRT1194319	hsa-miR-195	CLIP-seq
MIRT1194320	hsa-miR-3123	CLIP-seq
MIRT1194321	hsa-miR-3129-3p	CLIP-seq
MIRT1194322	hsa-miR-3133	CLIP-seq
MIRT1194323	hsa-miR-3659	CLIP-seq
MIRT1194324	hsa-miR-3919	CLIP-seq
MIRT1194325	hsa-miR-424	CLIP-seq
MIRT1194326	hsa-miR-4276	CLIP-seq
MIRT1194327	hsa-miR-4291	CLIP-seq
MIRT1194328	hsa-miR-4310	CLIP-seq
MIRT1194329	hsa-miR-4511	CLIP-seq
MIRT1194330	hsa-miR-4524	CLIP-seq
MIRT1194331	hsa-miR-4680-3p	CLIP-seq
MIRT1194332	hsa-miR-4775	CLIP-seq
MIRT1194333	hsa-miR-497	CLIP-seq
MIRT1194334	hsa-miR-503	CLIP-seq
MIRT1194335	hsa-miR-591	CLIP-seq
MIRT1194336	hsa-miR-628-5p	CLIP-seq
MIRT1194337	hsa-miR-646	CLIP-seq
MIRT2056404	hsa-miR-1284	CLIP-seq
MIRT2056405	hsa-miR-4684-5p	CLIP-seq
MIRT1194315	hsa-miR-129-5p	CLIP-seq
MIRT1194320	hsa-miR-3123	CLIP-seq
MIRT1194323	hsa-miR-3659	CLIP-seq
MIRT2284933	hsa-miR-374a	CLIP-seq
MIRT2284934	hsa-miR-374b	CLIP-seq
MIRT1194324	hsa-miR-3919	CLIP-seq
MIRT1194327	hsa-miR-4291	CLIP-seq
MIRT1194328	hsa-miR-4310	CLIP-seq
MIRT2284935	hsa-miR-4658	CLIP-seq
MIRT1194331	hsa-miR-4680-3p	CLIP-seq
MIRT1194332	hsa-miR-4775	CLIP-seq
MIRT2284936	hsa-miR-574-5p	CLIP-seq
MIRT1194336	hsa-miR-628-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0032281	Component	AMPA glutamate receptor complex	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1990138	Process	Neuron projection extension	IBA
GO:1990138	Process	Neuron projection extension	IEA

MIM	HGNC	e!Ensembl
607409	17972	ENSG00000124785

Q9NPD7

Protein name

Neuritin

Protein function

Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15056	NRN1	31 → 117	Neuritin protein family	Domain

Sequence

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKT
NIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGS
LLPAFPVLLVSLSAALATWLSF

Sequence length

142

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIAC EMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37024090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26700405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	26700405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26700405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26700405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37185612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19569075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	38165375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28107668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	19723343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31491902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34530960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27966079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16723126	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19569075, 25817395, 26423933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33787845	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16723126		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27901477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27901477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15958552, 16723126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29595190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31819478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27768648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31491902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31775891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19569075, 24350851, 26700405, 27855309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19569075		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26700405	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	26700405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28562156		★★★★★ ★☆☆☆☆ Found in Text Mining only

NRN1 (neuritin 1)