SPMAP2 (sperm microtubule associated protein 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 51298
Gene name Sperm microtubule associated protein 2
Gene symbol SPMAP2
Synonyms (NCBI Gene)
CT56THEGTHEG1
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT1423151 hsa-miR-3192 CLIP-seq
MIRT1423152 hsa-miR-4300 CLIP-seq
MIRT1423153 hsa-miR-609 CLIP-seq
MIRT1423154 hsa-miR-658 CLIP-seq
MIRT1423155 hsa-miR-920 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19060904, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0007283 Process Spermatogenesis IBA
GO:0007283 Process Spermatogenesis IEA
GO:0007283 Process Spermatogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609503 13706 ENSG00000105549
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P2T0
Protein name Sperm microtubule associated protein 2 (Cancer/testis antigen 56) (CT56) (Testicular haploid expressed gene protein)
Protein function May be involved (but not essential) in spermatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14912 THEG 188 → 216 Testicular haploid expressed repeat Repeat
PF14912 THEG 217 → 275 Testicular haploid expressed repeat Repeat
PF14912 THEG 284 → 343 Testicular haploid expressed repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:11173852}.
Sequence 
MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDP
EEELPPEEVAGEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKAR
KRRRRRRLMELAEPKINWQVLKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLED
TTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPVWPIPRSSLEYRASSRLKELAAPKI
RDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATLLEEWDPVPKPKPHVSDHNRL
LHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNEGYDRRPLASM
SLPPPKASPEKCDQPRPGL
Sequence length 379
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NON-SMALL CELL LUNG CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SAPHO SYNDROME — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (14)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 16406020
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 16406020
★★★★★
★☆☆☆☆
Found in Text Mining only
Azoospermia Azoospermia Pubtator 35173218 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 17317841
★★★★★
★☆☆☆☆
Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia Lymphoblastic Leukemia BEFREE 16406020
★★★★★
★☆☆☆☆
Found in Text Mining only
Hypogonadism Hypogonadism BEFREE 15970005
★★★★★
★☆☆☆☆
Found in Text Mining only
Infertility Male Male infertility Pubtator 35173218 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of ovary Ovarian cancer BEFREE 19333399
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 17151793
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of testis Malignant Neoplasm Of Testis BEFREE 25292049, 28739310
★★★★★
★☆☆☆☆
Found in Text Mining only