SLC15A3 (solute carrier family 15 member 3)

Gene

• Entrez ID: 51296
• Gene name: Solute carrier family 15 member 3
• Gene symbol: SLC15A3
• Synonyms (NCBI Gene): OCTP, PHT2, PTR3, hPHT2
• Chromosome: 11
• Chromosome location: 11q12.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1352729	hsa-miR-1296	CLIP-seq
MIRT1352730	hsa-miR-2861	CLIP-seq
MIRT1352731	hsa-miR-3652	CLIP-seq
MIRT1352732	hsa-miR-4430	CLIP-seq
MIRT1352733	hsa-miR-4492	CLIP-seq
MIRT1352734	hsa-miR-4498	CLIP-seq
MIRT1352735	hsa-miR-4512	CLIP-seq
MIRT1352736	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	24695226, 32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0015031	Process	Protein transport	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015333	Function	Peptide:proton symporter activity	TAS
GO:0015647	Function	Peptidoglycan transmembrane transporter activity	IEA
GO:0015647	Function	Peptidoglycan transmembrane transporter activity	ISS
GO:0015833	Process	Peptide transport	IEA
GO:0015835	Process	Peptidoglycan transport	IEA
GO:0015835	Process	Peptidoglycan transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	ISS
GO:0071916	Function	Dipeptide transmembrane transporter activity	IBA
GO:0071916	Function	Dipeptide transmembrane transporter activity	IDA	31073693
GO:0140206	Process	Dipeptide import across plasma membrane	IBA
GO:0140206	Process	Dipeptide import across plasma membrane	IDA	31073693
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 610408
• HGNC: 18068
• e!Ensembl: ENSG00000110446

Protein

• UniProt ID: Q8IY34
• Protein name: Solute carrier family 15 member 3 (Osteoclast transporter) (Peptide transporter 3) (Peptide/histidine transporter 2) (hPHT2)
• Protein function: Proton-coupled amino-acid transporter that transports free histidine and certain di- and tripeptides, and is involved in innate immune response (By similarity). Also able to transport carnosine (PubMed:31073693, PubMed:31254495). Involved in the
• PDB: 8WX2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00854	PTR2	101 → 523	POT family	Family

• Sequence:

  MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYL
  NSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPA
  TAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLT
  SFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLA
  FFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPG
  ASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVA
  LRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT
  SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGL
  EFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDL
  YFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG

• Sequence length: 581

Pathways

Reactome:

Proton/oligopeptide cotransporters

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	23301059	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29305856		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28465481	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31073693		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31073693		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28465481	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31073693		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20699414		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20699414, 22950754	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20019841	Associate	★☆☆☆☆ Found in Text Mining only