Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5129
Gene name	Cyclin dependent kinase 18
Gene symbol	CDK18
Synonyms (NCBI Gene)	PCTAIREPCTAIRE3PCTK3
Chromosome	1
Chromosome location	1q32.1

179

Show/Hide all (179)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017648	hsa-miR-335-5p	Microarray	18185580
MIRT029346	hsa-miR-26b-5p	Microarray	19088304
MIRT046594	hsa-miR-222-3p	CLASH	23622248
MIRT529054	hsa-miR-6808-5p	PAR-CLIP	22012620
MIRT529052	hsa-miR-6893-5p	PAR-CLIP	22012620
MIRT529053	hsa-miR-940	PAR-CLIP	22012620
MIRT529051	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT529049	hsa-miR-4514	PAR-CLIP	22012620
MIRT529050	hsa-miR-4692	PAR-CLIP	22012620
MIRT529048	hsa-miR-4673	PAR-CLIP	22012620
MIRT529047	hsa-miR-5695	PAR-CLIP	22012620
MIRT529045	hsa-miR-4722-5p	PAR-CLIP	22012620
MIRT529054	hsa-miR-6808-5p	PAR-CLIP	22012620
MIRT529052	hsa-miR-6893-5p	PAR-CLIP	22012620
MIRT529053	hsa-miR-940	PAR-CLIP	22012620
MIRT529051	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT529049	hsa-miR-4514	PAR-CLIP	22012620
MIRT529050	hsa-miR-4692	PAR-CLIP	22012620
MIRT529048	hsa-miR-4673	PAR-CLIP	22012620
MIRT529047	hsa-miR-5695	PAR-CLIP	22012620
MIRT529045	hsa-miR-4722-5p	PAR-CLIP	22012620
MIRT880689	hsa-miR-1207-5p	CLIP-seq
MIRT880690	hsa-miR-1908	CLIP-seq
MIRT880691	hsa-miR-1915	CLIP-seq
MIRT880692	hsa-miR-1972	CLIP-seq
MIRT880693	hsa-miR-2355-5p	CLIP-seq
MIRT880694	hsa-miR-3064-5p	CLIP-seq
MIRT880695	hsa-miR-3126-3p	CLIP-seq
MIRT880696	hsa-miR-378	CLIP-seq
MIRT880697	hsa-miR-378b	CLIP-seq
MIRT880698	hsa-miR-378c	CLIP-seq
MIRT880699	hsa-miR-378d	CLIP-seq
MIRT880700	hsa-miR-378e	CLIP-seq
MIRT880701	hsa-miR-378f	CLIP-seq
MIRT880702	hsa-miR-378h	CLIP-seq
MIRT880703	hsa-miR-378i	CLIP-seq
MIRT880704	hsa-miR-422a	CLIP-seq
MIRT880705	hsa-miR-448	CLIP-seq
MIRT880706	hsa-miR-4492	CLIP-seq
MIRT880707	hsa-miR-4498	CLIP-seq
MIRT880708	hsa-miR-4522	CLIP-seq
MIRT880709	hsa-miR-4638-3p	CLIP-seq
MIRT880710	hsa-miR-4650-5p	CLIP-seq
MIRT880711	hsa-miR-4717-5p	CLIP-seq
MIRT880712	hsa-miR-4725-5p	CLIP-seq
MIRT880713	hsa-miR-4726-3p	CLIP-seq
MIRT880714	hsa-miR-4732-3p	CLIP-seq
MIRT880715	hsa-miR-4736	CLIP-seq
MIRT880716	hsa-miR-4746-5p	CLIP-seq
MIRT880717	hsa-miR-4763-3p	CLIP-seq
MIRT880718	hsa-miR-504	CLIP-seq
MIRT880719	hsa-miR-663	CLIP-seq
MIRT880720	hsa-miR-762	CLIP-seq
MIRT880721	hsa-miR-891b	CLIP-seq
MIRT880722	hsa-miR-1202	CLIP-seq
MIRT880723	hsa-miR-1207-3p	CLIP-seq
MIRT880689	hsa-miR-1207-5p	CLIP-seq
MIRT880724	hsa-miR-1233	CLIP-seq
MIRT880725	hsa-miR-1266	CLIP-seq
MIRT880726	hsa-miR-1285	CLIP-seq
MIRT880690	hsa-miR-1908	CLIP-seq
MIRT880691	hsa-miR-1915	CLIP-seq
MIRT880692	hsa-miR-1972	CLIP-seq
MIRT880727	hsa-miR-21	CLIP-seq
MIRT880728	hsa-miR-2682	CLIP-seq
MIRT880694	hsa-miR-3064-5p	CLIP-seq
MIRT880729	hsa-miR-3134	CLIP-seq
MIRT880730	hsa-miR-3158-3p	CLIP-seq
MIRT880731	hsa-miR-3160-3p	CLIP-seq
MIRT880732	hsa-miR-3173-3p	CLIP-seq
MIRT880733	hsa-miR-3183	CLIP-seq
MIRT880734	hsa-miR-3187-5p	CLIP-seq
MIRT880735	hsa-miR-3194-5p	CLIP-seq
MIRT880736	hsa-miR-339-5p	CLIP-seq
MIRT880737	hsa-miR-34a	CLIP-seq
MIRT880738	hsa-miR-34c-5p	CLIP-seq
MIRT880739	hsa-miR-3664-3p	CLIP-seq
MIRT880740	hsa-miR-3682-3p	CLIP-seq
MIRT880741	hsa-miR-3688-3p	CLIP-seq
MIRT880696	hsa-miR-378	CLIP-seq
MIRT880697	hsa-miR-378b	CLIP-seq
MIRT880698	hsa-miR-378c	CLIP-seq
MIRT880699	hsa-miR-378d	CLIP-seq
MIRT880700	hsa-miR-378e	CLIP-seq
MIRT880701	hsa-miR-378f	CLIP-seq
MIRT880702	hsa-miR-378h	CLIP-seq
MIRT880703	hsa-miR-378i	CLIP-seq
MIRT880742	hsa-miR-3909	CLIP-seq
MIRT880743	hsa-miR-3945	CLIP-seq
MIRT880744	hsa-miR-3972	CLIP-seq
MIRT880745	hsa-miR-3978	CLIP-seq
MIRT880704	hsa-miR-422a	CLIP-seq
MIRT880746	hsa-miR-4253	CLIP-seq
MIRT880747	hsa-miR-4270	CLIP-seq
MIRT880748	hsa-miR-4287	CLIP-seq
MIRT880749	hsa-miR-4292	CLIP-seq
MIRT880750	hsa-miR-4323	CLIP-seq
MIRT880751	hsa-miR-4436b-3p	CLIP-seq
MIRT880752	hsa-miR-4441	CLIP-seq
MIRT880753	hsa-miR-4446-3p	CLIP-seq
MIRT880754	hsa-miR-4469	CLIP-seq
MIRT880755	hsa-miR-4486	CLIP-seq
MIRT880756	hsa-miR-4487	CLIP-seq
MIRT880706	hsa-miR-4492	CLIP-seq
MIRT880707	hsa-miR-4498	CLIP-seq
MIRT880757	hsa-miR-449a	CLIP-seq
MIRT880758	hsa-miR-449b	CLIP-seq
MIRT880759	hsa-miR-449c	CLIP-seq
MIRT880760	hsa-miR-4518	CLIP-seq
MIRT880761	hsa-miR-4534	CLIP-seq
MIRT880762	hsa-miR-4633-5p	CLIP-seq
MIRT880709	hsa-miR-4638-3p	CLIP-seq
MIRT880763	hsa-miR-4642	CLIP-seq
MIRT880764	hsa-miR-4656	CLIP-seq
MIRT880765	hsa-miR-4685-3p	CLIP-seq
MIRT880711	hsa-miR-4717-5p	CLIP-seq
MIRT880766	hsa-miR-4723-3p	CLIP-seq
MIRT880713	hsa-miR-4726-3p	CLIP-seq
MIRT880715	hsa-miR-4736	CLIP-seq
MIRT880716	hsa-miR-4746-5p	CLIP-seq
MIRT880717	hsa-miR-4763-3p	CLIP-seq
MIRT880767	hsa-miR-4779	CLIP-seq
MIRT880768	hsa-miR-4794	CLIP-seq
MIRT880769	hsa-miR-555	CLIP-seq
MIRT880770	hsa-miR-556-5p	CLIP-seq
MIRT880771	hsa-miR-558	CLIP-seq
MIRT880772	hsa-miR-590-5p	CLIP-seq
MIRT880773	hsa-miR-612	CLIP-seq
MIRT880774	hsa-miR-646	CLIP-seq
MIRT880719	hsa-miR-663	CLIP-seq
MIRT880720	hsa-miR-762	CLIP-seq
MIRT880721	hsa-miR-891b	CLIP-seq
MIRT1960875	hsa-miR-101	CLIP-seq
MIRT1960876	hsa-miR-1271	CLIP-seq
MIRT1960877	hsa-miR-128	CLIP-seq
MIRT1960878	hsa-miR-182	CLIP-seq
MIRT1960879	hsa-miR-27a	CLIP-seq
MIRT1960880	hsa-miR-27b	CLIP-seq
MIRT1960881	hsa-miR-299-3p	CLIP-seq
MIRT1960882	hsa-miR-3150a-3p	CLIP-seq
MIRT1960883	hsa-miR-3175	CLIP-seq
MIRT1960884	hsa-miR-4643	CLIP-seq
MIRT1960885	hsa-miR-4722-3p	CLIP-seq
MIRT1960886	hsa-miR-4755-3p	CLIP-seq
MIRT1960887	hsa-miR-491-5p	CLIP-seq
MIRT1960888	hsa-miR-513a-5p	CLIP-seq
MIRT1960889	hsa-miR-765	CLIP-seq
MIRT1960890	hsa-miR-939	CLIP-seq
MIRT1960891	hsa-miR-96	CLIP-seq
MIRT880689	hsa-miR-1207-5p	CLIP-seq
MIRT880751	hsa-miR-4436b-3p	CLIP-seq
MIRT880717	hsa-miR-4763-3p	CLIP-seq
MIRT2446694	hsa-miR-1245b-3p	CLIP-seq
MIRT880733	hsa-miR-3183	CLIP-seq
MIRT880748	hsa-miR-4287	CLIP-seq
MIRT2446695	hsa-miR-4326	CLIP-seq
MIRT2446696	hsa-miR-4330	CLIP-seq
MIRT880754	hsa-miR-4469	CLIP-seq
MIRT880765	hsa-miR-4685-3p	CLIP-seq
MIRT880766	hsa-miR-4723-3p	CLIP-seq
MIRT2446694	hsa-miR-1245b-3p	CLIP-seq
MIRT880733	hsa-miR-3183	CLIP-seq
MIRT880748	hsa-miR-4287	CLIP-seq
MIRT2446695	hsa-miR-4326	CLIP-seq
MIRT2446696	hsa-miR-4330	CLIP-seq
MIRT880754	hsa-miR-4469	CLIP-seq
MIRT880765	hsa-miR-4685-3p	CLIP-seq
MIRT880766	hsa-miR-4723-3p	CLIP-seq
MIRT880724	hsa-miR-1233	CLIP-seq
MIRT2446694	hsa-miR-1245b-3p	CLIP-seq
MIRT880733	hsa-miR-3183	CLIP-seq
MIRT880740	hsa-miR-3682-3p	CLIP-seq
MIRT880748	hsa-miR-4287	CLIP-seq
MIRT880749	hsa-miR-4292	CLIP-seq
MIRT2446695	hsa-miR-4326	CLIP-seq
MIRT2446696	hsa-miR-4330	CLIP-seq
MIRT880754	hsa-miR-4469	CLIP-seq
MIRT880765	hsa-miR-4685-3p	CLIP-seq
MIRT880766	hsa-miR-4723-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15161933, 25416956, 32296183, 33961781, 35271311, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031643	Process	Positive regulation of myelination	IDA	31028571
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901987	Process	Regulation of cell cycle phase transition	IBA

MIM	HGNC	e!Ensembl
169190	8751	ENSG00000117266

Q07002

Protein name

Cyclin-dependent kinase 18 (EC 2.7.11.22) (Cell division protein kinase 18) (PCTAIRE-motif protein kinase 3) (Serine/threonine-protein kinase PCTAIRE-3)

Protein function

May play a role in signal transduction cascades in terminally differentiated cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	144 → 425	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 expression is limited to several subcortical nuclei of the basal gangli and the spinal cord. Isoform 1 is widely expressed. {ECO:0000269|PubMed:15019984}.

Sequence

MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECST
FSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDL
PKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHE
EGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMH
NVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNE
VVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTP
TEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAAL
SHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF

Sequence length

474

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	30034634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35491766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32013938	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29695241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29695241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	29695241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31028571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27896979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31266951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31266951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30034634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31266951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33261069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDK18 (cyclin dependent kinase 18)