RXFP3 (relaxin family peptide receptor 3)

Gene

• Entrez ID: 51289
• Gene name: Relaxin family peptide receptor 3
• Gene symbol: RXFP3
• Synonyms (NCBI Gene): GPCR135, RLN3R1, RXFPR3, SALPR
• Chromosome: 5
• Chromosome location: 5p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018507	hsa-miR-335-5p	Microarray	18185580
MIRT029856	hsa-miR-26b-5p	Microarray	19088304
MIRT1323249	hsa-miR-486-3p	CLIP-seq
MIRT1921816	hsa-miR-1224-3p	CLIP-seq
MIRT1921817	hsa-miR-1260	CLIP-seq
MIRT1921818	hsa-miR-1260b	CLIP-seq
MIRT1921819	hsa-miR-1280	CLIP-seq
MIRT1921820	hsa-miR-1913	CLIP-seq
MIRT1921821	hsa-miR-324-3p	CLIP-seq
MIRT1921822	hsa-miR-4641	CLIP-seq
MIRT1921823	hsa-miR-532-3p	CLIP-seq
MIRT1921816	hsa-miR-1224-3p	CLIP-seq
MIRT1921817	hsa-miR-1260	CLIP-seq
MIRT1921818	hsa-miR-1260b	CLIP-seq
MIRT1921819	hsa-miR-1280	CLIP-seq
MIRT1921820	hsa-miR-1913	CLIP-seq
MIRT1921821	hsa-miR-324-3p	CLIP-seq
MIRT1922959	hsa-miR-3682-5p	CLIP-seq
MIRT1921822	hsa-miR-4641	CLIP-seq
MIRT1921823	hsa-miR-532-3p	CLIP-seq
MIRT2095890	hsa-miR-3200-3p	CLIP-seq
MIRT2095891	hsa-miR-4292	CLIP-seq
MIRT2095892	hsa-miR-4783-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10806363
GO:0004966	Function	Galanin receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10806363
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10806363
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021

Other IDs

• MIM: 609445
• HGNC: 24883
• e!Ensembl: ENSG00000182631

Protein

• UniProt ID: Q9NSD7
• Protein name: Relaxin-3 receptor 1 (RLN3 receptor 1) (G protein-coupled receptor SALPR) (G-protein coupled receptor GPCR135) (Relaxin family peptide receptor 3) (Somatostatin- and angiotensin-like peptide receptor)
• Protein function: Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	98 → 389	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in brain regions. Highest expression in substantia nigra and pituitary, followed by hippocampus, spinal cord, amygdala, caudate nucleus and corpus callosum, quite low level in cerebellum. In peripheral tissues,
• Sequence:

  MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA
  PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF
  VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR
  YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK
  VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA
  GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS
  QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA
  TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY

• Sequence length: 469

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Relaxin signaling pathway

Reactome:

G alpha (i) signalling events
Relaxin receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety disorder	Pubtator	27498038	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31220339		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30509219		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30509219		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	23135160		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20211485		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20211485	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30824200		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	29601823		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28726252, 30947365		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31220339		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30509219		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30131340		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30824200		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31220339		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24647315, 36803573	Associate	★☆☆☆☆ Found in Text Mining only