Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51285
Gene name	RAS like family 12
Gene symbol	RASL12
Synonyms (NCBI Gene)	RIS
Chromosome	15
Chromosome location	15q22.31

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments
MIRT1292564	hsa-miR-106a	CLIP-seq
MIRT1292565	hsa-miR-106b	CLIP-seq
MIRT1292566	hsa-miR-138	CLIP-seq
MIRT1292567	hsa-miR-153	CLIP-seq
MIRT1292568	hsa-miR-17	CLIP-seq
MIRT1292569	hsa-miR-193a-5p	CLIP-seq
MIRT1292570	hsa-miR-20a	CLIP-seq
MIRT1292571	hsa-miR-20b	CLIP-seq
MIRT1292572	hsa-miR-2115	CLIP-seq
MIRT1292573	hsa-miR-25	CLIP-seq
MIRT1292574	hsa-miR-3120-5p	CLIP-seq
MIRT1292575	hsa-miR-3133	CLIP-seq
MIRT1292576	hsa-miR-32	CLIP-seq
MIRT1292577	hsa-miR-3202	CLIP-seq
MIRT1292578	hsa-miR-346	CLIP-seq
MIRT1292579	hsa-miR-3609	CLIP-seq
MIRT1292580	hsa-miR-363	CLIP-seq
MIRT1292581	hsa-miR-3659	CLIP-seq
MIRT1292582	hsa-miR-3665	CLIP-seq
MIRT1292583	hsa-miR-367	CLIP-seq
MIRT1292584	hsa-miR-3690	CLIP-seq
MIRT1292585	hsa-miR-4254	CLIP-seq
MIRT1292586	hsa-miR-4265	CLIP-seq
MIRT1292587	hsa-miR-4268	CLIP-seq
MIRT1292588	hsa-miR-4280	CLIP-seq
MIRT1292589	hsa-miR-4288	CLIP-seq
MIRT1292590	hsa-miR-4296	CLIP-seq
MIRT1292591	hsa-miR-4299	CLIP-seq
MIRT1292592	hsa-miR-4322	CLIP-seq
MIRT1292593	hsa-miR-4417	CLIP-seq
MIRT1292594	hsa-miR-4437	CLIP-seq
MIRT1292595	hsa-miR-4448	CLIP-seq
MIRT1292596	hsa-miR-448	CLIP-seq
MIRT1292597	hsa-miR-4502	CLIP-seq
MIRT1292598	hsa-miR-4509	CLIP-seq
MIRT1292599	hsa-miR-4511	CLIP-seq
MIRT1292600	hsa-miR-4533	CLIP-seq
MIRT1292601	hsa-miR-4645-5p	CLIP-seq
MIRT1292602	hsa-miR-4658	CLIP-seq
MIRT1292603	hsa-miR-4673	CLIP-seq
MIRT1292604	hsa-miR-4674	CLIP-seq
MIRT1292605	hsa-miR-4680-5p	CLIP-seq
MIRT1292606	hsa-miR-4690-5p	CLIP-seq
MIRT1292607	hsa-miR-4744	CLIP-seq
MIRT1292608	hsa-miR-4758-5p	CLIP-seq
MIRT1292609	hsa-miR-4796-3p	CLIP-seq
MIRT1292610	hsa-miR-4799-5p	CLIP-seq
MIRT1292611	hsa-miR-519d	CLIP-seq
MIRT1292612	hsa-miR-548ah	CLIP-seq
MIRT1292613	hsa-miR-574-5p	CLIP-seq
MIRT1292614	hsa-miR-632	CLIP-seq
MIRT1292615	hsa-miR-92a	CLIP-seq
MIRT1292616	hsa-miR-92b	CLIP-seq
MIRT1292617	hsa-miR-93	CLIP-seq
MIRT2086925	hsa-miR-4252	CLIP-seq
MIRT2086926	hsa-miR-4722-3p	CLIP-seq
MIRT2608221	hsa-miR-1253	CLIP-seq
MIRT2608222	hsa-miR-2114	CLIP-seq
MIRT2608223	hsa-miR-339-5p	CLIP-seq
MIRT2608224	hsa-miR-370	CLIP-seq
MIRT2608225	hsa-miR-4676-5p	CLIP-seq
MIRT2608226	hsa-miR-4786-3p	CLIP-seq
MIRT2608227	hsa-miR-575	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NYN1

Protein name

Ras-like protein family member 12 (EC 3.6.5.2) (Ras-like protein Ris)

PDB

3C5C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	22 → 185	Ras family	Domain

Sequence

MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSE
ETVDHQPVHLRVMDTADLDTPRNCERYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHA
KETQRSIPALLLGNKLDMAQYRQVTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAV
REARRELEKSPLTRPLFISEERALPHQAPLTARHGLASCTFNTLSTINLKEMPTVAQAKL
VTVKSSRAQSKRKAPTLTLLKGFKIF

Sequence length

266

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILE ACID MALABSORPTION, PRIMARY, 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38084139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30523414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28831591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29687695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28831591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	24524923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	24524923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29574518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29574518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29568276		★★★★★ ★☆☆☆☆ Found in Text Mining only

RASL12 (RAS like family 12)