TLR7 (toll like receptor 7)

Gene

• Entrez ID: 51284
• Gene name: Toll like receptor 7
• Gene symbol: TLR7
• Synonyms (NCBI Gene): IMD74, SLEB17, TLR7-like
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438602	hsa-miR-758-3p	Luciferase reporter assay, Western blot, qRT-PCR	25008898
MIRT438602	hsa-miR-758-3p	Luciferase reporter assay, Western blot, qRT-PCR	25008898
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684075	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT449487	hsa-miR-8087	PAR-CLIP	22100165
MIRT449486	hsa-miR-586	PAR-CLIP	22100165
MIRT684097	hsa-miR-17-5p	Luciferase reporter assay	26041742
MIRT734567	hsa-let-7b-3p	qRT-PCR, Flow cytometry	33079387
MIRT735682	hsa-miR-132-5p	Immunofluorescence	31940779
MIRT736103	hsa-let-7a-3p	Microarray	31540501
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684075	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT449487	hsa-miR-8087	PAR-CLIP	22100165
MIRT449486	hsa-miR-586	PAR-CLIP	22100165
MIRT755537	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, Flow cytometry, ELISA	34808293
MIRT755537	hsa-miR-146a-5p	Western blotting, qRT-PCR	36210830
MIRT1427013	hsa-miR-1267	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427016	hsa-miR-1912	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT1427018	hsa-miR-3136-3p	CLIP-seq
MIRT1427019	hsa-miR-3688-3p	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427021	hsa-miR-4275	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT1427024	hsa-miR-4422	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT1427028	hsa-miR-4652-3p	CLIP-seq
MIRT1427029	hsa-miR-4690-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT1427032	hsa-miR-4778-3p	CLIP-seq
MIRT1427033	hsa-miR-488	CLIP-seq
MIRT1427034	hsa-miR-495	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT1427038	hsa-miR-659	CLIP-seq
MIRT1427039	hsa-miR-944	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT2127929	hsa-miR-197	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT2127931	hsa-miR-3187-3p	CLIP-seq
MIRT2127932	hsa-miR-3663-5p	CLIP-seq
MIRT2127933	hsa-miR-371-5p	CLIP-seq
MIRT2127934	hsa-miR-371b-5p	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT2127935	hsa-miR-4435	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT2127936	hsa-miR-4463	CLIP-seq
MIRT2127937	hsa-miR-4494	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT2127938	hsa-miR-4701-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT2127939	hsa-miR-4716-5p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2127942	hsa-miR-4781-3p	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2127943	hsa-miR-5096	CLIP-seq
MIRT2127944	hsa-miR-548s	CLIP-seq
MIRT2127945	hsa-miR-588	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2127947	hsa-miR-640	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT2127929	hsa-miR-197	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT2127931	hsa-miR-3187-3p	CLIP-seq
MIRT2349566	hsa-miR-338-3p	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT2127935	hsa-miR-4435	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT2127936	hsa-miR-4463	CLIP-seq
MIRT2127937	hsa-miR-4494	CLIP-seq
MIRT2349567	hsa-miR-4530	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT2349568	hsa-miR-4659a-3p	CLIP-seq
MIRT2349569	hsa-miR-4659b-3p	CLIP-seq
MIRT2349570	hsa-miR-4691-5p	CLIP-seq
MIRT2349571	hsa-miR-4695-3p	CLIP-seq
MIRT2127938	hsa-miR-4701-5p	CLIP-seq
MIRT2349572	hsa-miR-4713-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT2127939	hsa-miR-4716-5p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2127942	hsa-miR-4781-3p	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2127943	hsa-miR-5096	CLIP-seq
MIRT2349574	hsa-miR-532-3p	CLIP-seq
MIRT2127944	hsa-miR-548s	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127945	hsa-miR-588	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2127947	hsa-miR-640	CLIP-seq
MIRT2349575	hsa-miR-766	CLIP-seq
MIRT2349576	hsa-miR-942	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2643094	hsa-miR-101	CLIP-seq
MIRT2643095	hsa-miR-1261	CLIP-seq
MIRT2643096	hsa-miR-144	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2693231	hsa-miR-1323	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2693232	hsa-miR-548aa	CLIP-seq
MIRT2693233	hsa-miR-548o	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	16423052;20658750
RELA	Activation	16423052;20658750

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002376	Process	Immune system process	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	16111635
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IMP	35477763
GO:0003727	Function	Single-stranded RNA binding	ISS
GO:0005515	Function	Protein binding	IPI	33432245
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19740627
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IBA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	35477763
GO:0007254	Process	JNK cascade	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032009	Component	Early phagosome	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16286015
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	16286015
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19740627
GO:0032757	Process	Positive regulation of interleukin-8 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16188996
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IBA
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IDA	12032557
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IEA
GO:0034158	Process	Toll-like receptor 8 signaling pathway	IEA
GO:0035197	Function	SiRNA binding	IEA
GO:0035197	Function	SiRNA binding	ISS
GO:0036020	Component	Endolysosome membrane	IEA
GO:0036020	Component	Endolysosome membrane	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	12032557, 19740627
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	35477763
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEP	32634389
GO:0051607	Process	Defense response to virus	IMP	16188996
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070305	Process	Response to cGMP	IMP	35477763
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0098542	Process	Defense response to other organism	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0140894	Process	Endolysosomal toll-like receptor signaling pathway	IEA

Other IDs

• MIM: 300365
• HGNC: 15631
• e!Ensembl: ENSG00000196664

Protein

• UniProt ID: Q9NYK1
• Protein name: Toll-like receptor 7
• Protein function: Endosomal receptor that plays a key role in innate and adaptive immunity (PubMed:14976261, PubMed:32433612). Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or
• PDB: 7CYN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	496 → 554	Leucine rich repeat	Repeat
  PF00560	LRR_1	700 → 743	Leucine Rich Repeat	Repeat
  PF01582	TIR	890 → 1048	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells. Expressed in peripheral mononuclear blood cells (PubMed:32706371). {ECO:0000269|PubMed:32706371}.
• Sequence:

  MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
  GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
  RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
  QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
  QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
  SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
  NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
  KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
  EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
  LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
  LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
  SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
  CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
  HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
  ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
  DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
  YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
  AHPYFWQCLKNALATDNHVAYSQVFKETV

• Sequence length: 1049

Pathways

KEGG:

Neutrophil extracellular trap formation
Toll-like receptor signaling pathway
Measles
Influenza A
Coronavirus disease - COVID-19

Reactome:

Trafficking and processing of endosomal TLR
Toll Like Receptor 7/8 (TLR7/8) Cascade
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 74, COVID-19-related, X-linked	Pathogenic	rs2042915990, rs200553089	RCV001254821 RCV001254822	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Systemic lupus erythematosus	Pathogenic	rs2147245859	RCV002259554	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Systemic lupus erythematosus 17	Pathogenic	rs2147245859, rs2147245261	RCV002251771 RCV002248405	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TLR7-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	15606509, 24225049		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	28403045		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23790156, 29968427		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30546943		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	26238718		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	20309865		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18385087		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	26888781	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22857391, 27667736, 28228119, 28681506, 30237869		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	31270708, 31571275		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	31571275		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30630901		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	34981838	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29533758		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31615993		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30864219	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29885943		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29885943		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	32708790	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	24336024	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22787112, 27864310, 28405010, 30108025		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28777892, 31105830, 31694883		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	35508687	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28935693	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	33936047	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16052591, 18765427, 21179534, 22730373, 24740301, 30091955, 31376255, 33377396	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31501466	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18682521, 25203745, 26725554, 28539639, 28579374, 28592890, 29122671, 30102794		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18682521		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19643938, 23861935, 24375473, 26725554, 28592890, 33236850	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26815632, 32513781	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31730654		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34686943	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22787112, 27864310, 28405010, 30108025		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27864310	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22226452	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18613842, 19094215, 19956107, 21543762, 21734241, 22024499, 23150717, 24018482, 24071890, 24352680, 25229618, 25541140, 25848864, 26512111, 27175635, 27600904, 28031336, 28093526, 28652396, 28751890, 28928743, 29118245, 29363775, 29374079, 29599669, 29611821, 30581114, 30610201, 30671059, 31501466, 31546246, 31552019, 31681326, 31687820, 31694883		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23386618, 24375473, 24740301, 30230983, 31069824, 31501466, 32219875, 37723501, 38077311	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18474259		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21167247, 23065292, 25650422		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	17075576	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	21832949, 27590984, 29909011		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25550860		★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28432455		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31789409, 33679700	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	26741133, 28592890	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28592890		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30610800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28857981		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26888781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17313672	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27588480	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28963470	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25550860		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31314777, 31381571	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18794336	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21527067	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34987310	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26556041, 28857981, 31189943		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28901470		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28250051		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27864310	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28028951		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28028951	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28017496		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21527067		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29909011		★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	17075576	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16517754, 18474259, 26041742		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30194882		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	29271858	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31134093		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27084119, 29794016		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22185629, 27895398	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37049910	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20728343, 22371291, 30184100, 31629935		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28569041	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19592080, 22048980, 27188997, 37626865	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	22048980		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25559326, 28088184, 28963470, 29247724, 29247725		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21832949, 27590984, 29909011		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19118885		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25882064		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25882064		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25882064		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31449915		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	20957032, 37567916	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19094116	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	28595240		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31841992		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	19380832, 28665921, 30551443, 30564235		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	19639721	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	28935206	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	29572462		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	20309865		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	20309865, 31135059	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	21670437, 29988398		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25586463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25586463, 31135059		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25586463, 31531603	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25586463	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36552771	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28028829		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25586463		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28843858		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31511910		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	31511910	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30736860		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21990957	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30125542		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23489702, 27135246		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31825829		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34134771, 34404444	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	23382559, 29687651		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27818460, 31489594	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24517461, 25430040, 28013570		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	24517461, 28013570	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	28013570	Inhibit	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	24517461	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	39508448	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	18949362		★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	26432597		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28321161, 28963470	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	28321161, 28963470	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25126563, 26023919, 30232187	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	23425350, 27135246	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	25229618		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31531603	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	21670437, 29569859		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22344343		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34112765	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27895398, 34482844, 34686943, 34981838	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28170444		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	40062898	Stimulate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	22022401, 29720451		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21953855		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36847442	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28665921, 30564235		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	28595240		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	40389926	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27427388		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	20571165		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30429335		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21478107	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19449004, 20859626	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31434732		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	24307172	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19449004	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25319656, 31613009		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23069256		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25126563, 31134093		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27135246, 28963470	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	27284092	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20237413, 34596365	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30546943		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17907191, 18034431, 18373699, 18613842, 22890025, 23382559, 24449581, 26144250, 27600904, 29052537, 29611821, 29963056, 30108025, 30518690		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16887967, 18373699, 20733074, 21396113, 22513098, 22952664, 23468661, 24375473, 24445780, 24692849, 25210799, 25485543, 27699260, 28506291, 29321042, 30210502, 30230983, 30314758, 30864219, 31092820, 31231380, 31501466, 31707854, 33336388, 34419106, 34440442, 34596588, 35083340, 35833144, 36180106, 37001433, 37733447, 37840148, 38077311, 38230454, 40516124	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23497717, 24445780	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	17907191, 18034431, 18373699, 18613842, 23382559, 24449581, 26144250, 27600904, 29052537, 29599669, 29611821, 29963056, 30108025, 30518690		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17907191, 18034431, 18373699, 18613842, 19287148, 19473567, 20525845, 20619604, 20733074, 21187399, 21396113, 22065095, 22325161, 22505023, 23150717, 23382559, 23467932, 23468661, 23564191, 24445780, 24449581, 24919757, 25210799, 25695778, 26018863, 26144250, 26512111, 26762473, 27159270, 27600904, 28363108, 28544067, 28595240, 29052537, 29321445, 29374079, 29515028, 29599669, 29611821, 29769437, 29884703, 29889098, 29963056, 30108025, 30210502, 30276444, 30314758, 30518690, 30581114, 30610165, 30753473, 30838156, 31092820, 31231380, 31296302, 31324689, 31546246, 31546763, 31552019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	19451267, 20525845, 20619604, 29102373, 29884703		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27635115, 35392757	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	17907191, 18034431, 18373699, 18613842, 23382559, 24449581, 26144250, 27600904, 29052537, 29611821, 29963056, 30108025, 30518690		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16517754		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16517754	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27890931, 29158790		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	30630901		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25226551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	25226551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	28432455		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28901470		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23023703, 26134824, 26238718, 26718740, 31409607, 31615993, 31729370		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23790156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25550860		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17804388, 25941114, 26718740, 29964062, 30018715, 30209066, 30429335, 30610006, 31143525, 31784317		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27522582, 28212561, 28919783, 29370558, 30149266, 31589013		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	31552019		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	36859461	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31135059	Stimulate	★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	33336388	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30121951	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31511910	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28707750, 34193364	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23593278, 35365613	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23636665, 26996115, 27036414	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23950974, 24814238		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	26996115, 27609294, 28273784		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	34922439	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16093456		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26723518, 29363775		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24690917		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24690917, 34130612	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30830156		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	31531603	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28250051, 31324689		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	20309865, 31135059		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	20309865, 31135059	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	39529136	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31135059		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31238894		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31238894	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18794336, 20067543, 21423261, 21527067, 23023703, 23521528, 23790156, 24573220, 25941114, 26134824, 27456065, 28196735, 28456734, 28637878, 28666747, 28857981, 28931759, 29170511, 29563317, 29968427, 30021725, 30276880, 30415018, 31093508, 31238894, 31511088, 31615993, 31729370		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	26512111, 31354711		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	22649203		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29758080		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21461352, 36552771	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21337319, 23255072, 32788627, 35508687	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35734177	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	35508687, 35785145	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	19452306		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28901470		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30610800, 35464051	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23023703, 26134824, 26238718, 26718740, 31409607, 31615993, 31729370		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31615993		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35536778	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	30936294		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	36349750	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	24445780		★☆☆☆☆ Found in Text Mining only
Pericardial Effusion	Pericardial effusion	Pubtator	24445780	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30517775		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	21734241, 29873766, 30864219		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	20309865, 21670437, 31135059		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	20309865, 31135059	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23790156		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	31489594	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	23489702, 29947302, 30926417		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29794016		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18613842, 19703986, 24057248, 28054376, 28339016, 28469254, 28761880, 28935206, 29859222, 30551443, 31659208		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28935206	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32757672	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19118885		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21179534, 26662519, 27988432, 28495399, 31086948, 31501466		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	22857391, 28228119	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	24071890		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30616121		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28569041		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26889043, 28422377, 31045897		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25113744, 26332048, 27943374, 29655283, 30446998, 30846988	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31702822		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29500135		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	19516264	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28857981		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18794336, 28857981, 30926058, 31599020		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21990957		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17201162	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25941114, 28856441, 30794027	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25941114, 29930251, 30794027		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30794027		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30125542		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33982398	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	23951210		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	33377396, 35508687	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29147913, 29673738		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29158790, 31048012		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24517461		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31511910		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	31511910	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	31069824	Stimulate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	36758851	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27084119		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	25226551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25550860	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25550860	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29767328		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21527067	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	23221735		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23221735	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25309919	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23065292		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30930901		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	27825468		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	20634142		★☆☆☆☆ Found in Text Mining only