Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51268
Gene name	Pipecolic acid and sarcosine oxidase
Gene symbol	PIPOX
Synonyms (NCBI Gene)	LPIPOX
Chromosome	17
Chromosome location	17q11.2

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003818	hsa-miR-197-3p	Microarray	16822819
MIRT1236069	hsa-miR-1244	CLIP-seq
MIRT1236070	hsa-miR-1257	CLIP-seq
MIRT1236071	hsa-miR-125a-3p	CLIP-seq
MIRT1236072	hsa-miR-1275	CLIP-seq
MIRT1236073	hsa-miR-1307	CLIP-seq
MIRT1236074	hsa-miR-1343	CLIP-seq
MIRT1236075	hsa-miR-3115	CLIP-seq
MIRT1236076	hsa-miR-3176	CLIP-seq
MIRT1236077	hsa-miR-3192	CLIP-seq
MIRT1236078	hsa-miR-3611	CLIP-seq
MIRT1236079	hsa-miR-3675-5p	CLIP-seq
MIRT1236080	hsa-miR-3922-3p	CLIP-seq
MIRT1236081	hsa-miR-3934	CLIP-seq
MIRT1236082	hsa-miR-4284	CLIP-seq
MIRT1236083	hsa-miR-4299	CLIP-seq
MIRT1236084	hsa-miR-4300	CLIP-seq
MIRT1236085	hsa-miR-4314	CLIP-seq
MIRT1236086	hsa-miR-4421	CLIP-seq
MIRT1236087	hsa-miR-4438	CLIP-seq
MIRT1236088	hsa-miR-4450	CLIP-seq
MIRT1236089	hsa-miR-4454	CLIP-seq
MIRT1236090	hsa-miR-4456	CLIP-seq
MIRT1236091	hsa-miR-4525	CLIP-seq
MIRT1236092	hsa-miR-4532	CLIP-seq
MIRT1236093	hsa-miR-4638-5p	CLIP-seq
MIRT1236094	hsa-miR-4646-5p	CLIP-seq
MIRT1236095	hsa-miR-4665-5p	CLIP-seq
MIRT1236096	hsa-miR-4694-5p	CLIP-seq
MIRT1236097	hsa-miR-4703-3p	CLIP-seq
MIRT1236098	hsa-miR-4715-3p	CLIP-seq
MIRT1236099	hsa-miR-4723-5p	CLIP-seq
MIRT1236100	hsa-miR-4757-5p	CLIP-seq
MIRT1236101	hsa-miR-4787-3p	CLIP-seq
MIRT1236102	hsa-miR-5095	CLIP-seq
MIRT1236103	hsa-miR-548q	CLIP-seq
MIRT1236104	hsa-miR-625	CLIP-seq
MIRT1236105	hsa-miR-764	CLIP-seq
MIRT1236106	hsa-miR-920	CLIP-seq
MIRT1236071	hsa-miR-125a-3p	CLIP-seq
MIRT2069463	hsa-miR-1297	CLIP-seq
MIRT1236073	hsa-miR-1307	CLIP-seq
MIRT1236074	hsa-miR-1343	CLIP-seq
MIRT2069464	hsa-miR-26a	CLIP-seq
MIRT2069465	hsa-miR-26b	CLIP-seq
MIRT2069466	hsa-miR-3152-5p	CLIP-seq
MIRT1236076	hsa-miR-3176	CLIP-seq
MIRT2069467	hsa-miR-361-3p	CLIP-seq
MIRT1236080	hsa-miR-3922-3p	CLIP-seq
MIRT1236081	hsa-miR-3934	CLIP-seq
MIRT1236082	hsa-miR-4284	CLIP-seq
MIRT1236087	hsa-miR-4438	CLIP-seq
MIRT1236088	hsa-miR-4450	CLIP-seq
MIRT2069468	hsa-miR-4452	CLIP-seq
MIRT1236089	hsa-miR-4454	CLIP-seq
MIRT2069469	hsa-miR-4465	CLIP-seq
MIRT1236091	hsa-miR-4525	CLIP-seq
MIRT1236093	hsa-miR-4638-5p	CLIP-seq
MIRT1236098	hsa-miR-4715-3p	CLIP-seq
MIRT2069470	hsa-miR-4753-3p	CLIP-seq
MIRT1236100	hsa-miR-4757-5p	CLIP-seq
MIRT1236101	hsa-miR-4787-3p	CLIP-seq
MIRT1236102	hsa-miR-5095	CLIP-seq
MIRT2069471	hsa-miR-545	CLIP-seq
MIRT1236105	hsa-miR-764	CLIP-seq
MIRT2296796	hsa-miR-122	CLIP-seq
MIRT2296797	hsa-miR-129-5p	CLIP-seq
MIRT2069463	hsa-miR-1297	CLIP-seq
MIRT1236073	hsa-miR-1307	CLIP-seq
MIRT2296798	hsa-miR-130a	CLIP-seq
MIRT2296799	hsa-miR-130b	CLIP-seq
MIRT2296800	hsa-miR-1827	CLIP-seq
MIRT2069464	hsa-miR-26a	CLIP-seq
MIRT2069465	hsa-miR-26b	CLIP-seq
MIRT2296801	hsa-miR-298	CLIP-seq
MIRT2296802	hsa-miR-301a	CLIP-seq
MIRT2296803	hsa-miR-301b	CLIP-seq
MIRT2296804	hsa-miR-3135b	CLIP-seq
MIRT2296805	hsa-miR-3652	CLIP-seq
MIRT2296806	hsa-miR-3666	CLIP-seq
MIRT1236082	hsa-miR-4284	CLIP-seq
MIRT2296807	hsa-miR-4295	CLIP-seq
MIRT2296808	hsa-miR-4316	CLIP-seq
MIRT2296809	hsa-miR-4430	CLIP-seq
MIRT1236087	hsa-miR-4438	CLIP-seq
MIRT1236088	hsa-miR-4450	CLIP-seq
MIRT2069469	hsa-miR-4465	CLIP-seq
MIRT2296810	hsa-miR-454	CLIP-seq
MIRT1236093	hsa-miR-4638-5p	CLIP-seq
MIRT2296811	hsa-miR-4639-3p	CLIP-seq
MIRT1236098	hsa-miR-4715-3p	CLIP-seq
MIRT1236101	hsa-miR-4787-3p	CLIP-seq
MIRT2296812	hsa-miR-4797-5p	CLIP-seq
MIRT1236102	hsa-miR-5095	CLIP-seq
MIRT2296813	hsa-miR-652	CLIP-seq
MIRT2069463	hsa-miR-1297	CLIP-seq
MIRT2069464	hsa-miR-26a	CLIP-seq
MIRT2069465	hsa-miR-26b	CLIP-seq
MIRT2594247	hsa-miR-3149	CLIP-seq
MIRT2069466	hsa-miR-3152-5p	CLIP-seq
MIRT2594248	hsa-miR-4264	CLIP-seq
MIRT2069469	hsa-miR-4465	CLIP-seq
MIRT1236092	hsa-miR-4532	CLIP-seq
MIRT1236098	hsa-miR-4715-3p	CLIP-seq
MIRT2594249	hsa-miR-4735-5p	CLIP-seq
MIRT2069470	hsa-miR-4753-3p	CLIP-seq
MIRT2594250	hsa-miR-4775	CLIP-seq
MIRT2594251	hsa-miR-590-3p	CLIP-seq
MIRT2069463	hsa-miR-1297	CLIP-seq
MIRT2069464	hsa-miR-26a	CLIP-seq
MIRT2069465	hsa-miR-26b	CLIP-seq
MIRT2594247	hsa-miR-3149	CLIP-seq
MIRT2069466	hsa-miR-3152-5p	CLIP-seq
MIRT2687937	hsa-miR-3591-5p	CLIP-seq
MIRT2687938	hsa-miR-3681	CLIP-seq
MIRT2687939	hsa-miR-4460	CLIP-seq
MIRT2069469	hsa-miR-4465	CLIP-seq
MIRT1236092	hsa-miR-4532	CLIP-seq
MIRT1236098	hsa-miR-4715-3p	CLIP-seq
MIRT2687940	hsa-miR-4727-3p	CLIP-seq
MIRT2594249	hsa-miR-4735-5p	CLIP-seq
MIRT2069470	hsa-miR-4753-3p	CLIP-seq
MIRT2594250	hsa-miR-4775	CLIP-seq
MIRT2594251	hsa-miR-590-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	10642506
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006554	Process	Lysine catabolic process	TAS
GO:0008115	Function	Sarcosine oxidase activity	IBA
GO:0008115	Function	Sarcosine oxidase activity	IDA	10642506
GO:0008115	Function	Sarcosine oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0033514	Process	L-lysine catabolic process to acetyl-CoA via L-pipecolate	IBA
GO:0033514	Process	L-lysine catabolic process to acetyl-CoA via L-pipecolate	IDA	10642506
GO:0050031	Function	L-pipecolate oxidase activity	IBA
GO:0050031	Function	L-pipecolate oxidase activity	IDA	10642506
GO:0050031	Function	L-pipecolate oxidase activity	IEA
GO:0050031	Function	L-pipecolate oxidase activity	NAS	10772957
GO:0050031	Function	L-pipecolate oxidase activity	TAS
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA

MIM	HGNC	e!Ensembl
616713	17804	ENSG00000179761

Q9P0Z9

Protein name

Peroxisomal sarcosine oxidase (PSO) (EC 1.5.3.1) (EC 1.5.3.7) (L-pipecolate oxidase) (L-pipecolic acid oxidase)

Protein function

Metabolizes sarcosine and L-pipecolic acid.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01266	DAO	9 → 364	FAD dependent oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the liver and kidney. {ECO:0000269|PubMed:10642506}.

Sequence

MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Lysine degradation Metabolic pathways Peroxisome		Lysine catabolism Peroxisomal protein import

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low-frequency hearing loss	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low-frequency sensorineural hearing impairment	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEROXISOMAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	2653074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy, Neonatal	Adrenoleukodystrophy	CTD_human_DG	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24884785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24884785, 25550822, 26339363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25837163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25837163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28058013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28058013, 34965262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34215202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	8721499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperpipecolic Acidemia	Hyperpipecolic Acidemia	CTD_human_DG	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23695493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	24884785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17277414, 29374408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisomal Dysfunction, General	Peroxisomal Dysfunction	CTD_human_DG	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisomal Dysfunction, Multiple	Peroxisomal Dysfunction	CTD_human_DG	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisomal Dysfunction, Single	Peroxisomal Dysfunction	CTD_human_DG	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	10642506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23633921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27471948, 30633377, 8721499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	8721499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia, Childhood	Schizophrenia	CLINVAR_DG	26508570		★★★★★ ★☆☆☆☆ Found in Text Mining only

PIPOX (pipecolic acid and sarcosine oxidase)