Gene Gene information from NCBI Gene database.
Entrez ID 51247
Gene name Poly(A) binding protein interacting protein 2
Gene symbol PAIP2
Synonyms (NCBI Gene)
PAIP-2PAIP2A
Chromosome 5
Chromosome location 5q31.2
miRNA miRNA information provided by mirtarbase database.
265
miRTarBase ID miRNA Experiments Reference
MIRT049925 hsa-miR-30a-3p CLASH 23622248
MIRT046752 hsa-miR-222-3p CLASH 23622248
MIRT046752 hsa-miR-222-3p PAR-CLIP 20371350
MIRT256500 hsa-miR-221-3p PAR-CLIP 20371350
MIRT571835 hsa-miR-218-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000900 Function MRNA regulatory element binding translation repressor activity IEA
GO:0003729 Function MRNA binding IEA
GO:0005515 Function Protein binding IPI 11172725, 14685257, 16601676, 32296183, 32529326, 32814053, 33961781, 35511136, 37100772
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 11172725
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605604 17970 ENSG00000120727
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BPZ3
Protein name Polyadenylate-binding protein-interacting protein 2 (PABP-interacting protein 2) (PAIP-2) (Poly(A)-binding protein-interacting protein 2)
Protein function Acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. Displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP
PDB 1JGN , 3KUS , 3KUT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07145 PAM2 106 123 Ataxin-2 C-terminal region Motif
Tissue specificity TISSUE SPECIFICITY: Expressed at highest level in testis, but also abundant in brain, cervix, lung, ovary, placenta, adipose tissue, thymus and thyroid. {ECO:0000269|PubMed:16804161}.
Sequence
MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEELWEEEFIERC
FQEMLEEEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVP
GVK
YGNI
Sequence length 127
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLORECTAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Carcinoma BEFREE 16641910
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer CTD_human_DG 25944804
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms CTD_human_DG 25944804
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma Head And Neck Carcinoma BEFREE 16641910
★☆☆☆☆
Found in Text Mining only
Head and Neck Neoplasms Head and neck neoplasm Pubtator 16641910 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Head and Neck Neoplasm Head and neck cancer BEFREE 16641910
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 16641910
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Squamous cell carcinoma Pubtator 16641910, 24403051 Associate
★☆☆☆☆
Found in Text Mining only