Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51231
Gene name	VRK serine/threonine kinase 3
Gene symbol	VRK3
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.33
Summary	This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be

143

Show/Hide all (143)

miRTarBase ID	miRNA	Experiments
MIRT1487508	hsa-miR-1245b-5p	CLIP-seq
MIRT1487509	hsa-miR-1267	CLIP-seq
MIRT1487510	hsa-miR-1299	CLIP-seq
MIRT1487511	hsa-miR-1972	CLIP-seq
MIRT1487512	hsa-miR-21	CLIP-seq
MIRT1487513	hsa-miR-214	CLIP-seq
MIRT1487514	hsa-miR-23a	CLIP-seq
MIRT1487515	hsa-miR-23b	CLIP-seq
MIRT1487516	hsa-miR-23c	CLIP-seq
MIRT1487517	hsa-miR-3064-5p	CLIP-seq
MIRT1487518	hsa-miR-3142	CLIP-seq
MIRT1487519	hsa-miR-3179	CLIP-seq
MIRT1487520	hsa-miR-323-3p	CLIP-seq
MIRT1487521	hsa-miR-330-3p	CLIP-seq
MIRT1487522	hsa-miR-3619-5p	CLIP-seq
MIRT1487523	hsa-miR-3682-5p	CLIP-seq
MIRT1487524	hsa-miR-3688-3p	CLIP-seq
MIRT1487525	hsa-miR-3978	CLIP-seq
MIRT1487526	hsa-miR-4257	CLIP-seq
MIRT1487527	hsa-miR-4273	CLIP-seq
MIRT1487528	hsa-miR-4320	CLIP-seq
MIRT1487529	hsa-miR-4436b-3p	CLIP-seq
MIRT1487530	hsa-miR-4490	CLIP-seq
MIRT1487531	hsa-miR-4650-5p	CLIP-seq
MIRT1487532	hsa-miR-4652-3p	CLIP-seq
MIRT1487533	hsa-miR-4677-3p	CLIP-seq
MIRT1487534	hsa-miR-4677-5p	CLIP-seq
MIRT1487535	hsa-miR-4679	CLIP-seq
MIRT1487536	hsa-miR-4684-3p	CLIP-seq
MIRT1487537	hsa-miR-4690-5p	CLIP-seq
MIRT1487538	hsa-miR-4694-3p	CLIP-seq
MIRT1487539	hsa-miR-4717-5p	CLIP-seq
MIRT1487540	hsa-miR-4774-5p	CLIP-seq
MIRT1487541	hsa-miR-4777-5p	CLIP-seq
MIRT1487542	hsa-miR-4782-5p	CLIP-seq
MIRT1487543	hsa-miR-516b	CLIP-seq
MIRT1487544	hsa-miR-518d-5p	CLIP-seq
MIRT1487545	hsa-miR-519b-5p	CLIP-seq
MIRT1487546	hsa-miR-519c-5p	CLIP-seq
MIRT1487547	hsa-miR-520c-5p	CLIP-seq
MIRT1487548	hsa-miR-526a	CLIP-seq
MIRT1487549	hsa-miR-556-3p	CLIP-seq
MIRT1487550	hsa-miR-579	CLIP-seq
MIRT1487551	hsa-miR-590-5p	CLIP-seq
MIRT1487552	hsa-miR-627	CLIP-seq
MIRT1487553	hsa-miR-761	CLIP-seq
MIRT1487554	hsa-miR-892b	CLIP-seq
MIRT2146759	hsa-miR-1197	CLIP-seq
MIRT1487517	hsa-miR-3064-5p	CLIP-seq
MIRT2146760	hsa-miR-3136-3p	CLIP-seq
MIRT1487519	hsa-miR-3179	CLIP-seq
MIRT2146761	hsa-miR-4265	CLIP-seq
MIRT2146762	hsa-miR-4267	CLIP-seq
MIRT2146763	hsa-miR-4296	CLIP-seq
MIRT2146764	hsa-miR-4322	CLIP-seq
MIRT2146765	hsa-miR-4417	CLIP-seq
MIRT2146766	hsa-miR-4426	CLIP-seq
MIRT1487529	hsa-miR-4436b-3p	CLIP-seq
MIRT2146767	hsa-miR-4647	CLIP-seq
MIRT2146768	hsa-miR-4662b	CLIP-seq
MIRT2146769	hsa-miR-496	CLIP-seq
MIRT1487554	hsa-miR-892b	CLIP-seq
MIRT2146759	hsa-miR-1197	CLIP-seq
MIRT2367281	hsa-miR-1207-5p	CLIP-seq
MIRT1487508	hsa-miR-1245b-5p	CLIP-seq
MIRT1487513	hsa-miR-214	CLIP-seq
MIRT1487514	hsa-miR-23a	CLIP-seq
MIRT1487515	hsa-miR-23b	CLIP-seq
MIRT1487516	hsa-miR-23c	CLIP-seq
MIRT2146760	hsa-miR-3136-3p	CLIP-seq
MIRT1487518	hsa-miR-3142	CLIP-seq
MIRT2367282	hsa-miR-3158-3p	CLIP-seq
MIRT1487520	hsa-miR-323-3p	CLIP-seq
MIRT1487522	hsa-miR-3619-5p	CLIP-seq
MIRT1487526	hsa-miR-4257	CLIP-seq
MIRT2146761	hsa-miR-4265	CLIP-seq
MIRT2367283	hsa-miR-4266	CLIP-seq
MIRT2146762	hsa-miR-4267	CLIP-seq
MIRT2146763	hsa-miR-4296	CLIP-seq
MIRT2146764	hsa-miR-4322	CLIP-seq
MIRT2146765	hsa-miR-4417	CLIP-seq
MIRT1487531	hsa-miR-4650-5p	CLIP-seq
MIRT2367284	hsa-miR-4685-5p	CLIP-seq
MIRT1487537	hsa-miR-4690-5p	CLIP-seq
MIRT2367285	hsa-miR-4695-5p	CLIP-seq
MIRT2367286	hsa-miR-4736	CLIP-seq
MIRT2367287	hsa-miR-4763-3p	CLIP-seq
MIRT2367288	hsa-miR-4779	CLIP-seq
MIRT2367289	hsa-miR-615-5p	CLIP-seq
MIRT1487552	hsa-miR-627	CLIP-seq
MIRT1487553	hsa-miR-761	CLIP-seq
MIRT1487554	hsa-miR-892b	CLIP-seq
MIRT1487514	hsa-miR-23a	CLIP-seq
MIRT1487515	hsa-miR-23b	CLIP-seq
MIRT1487516	hsa-miR-23c	CLIP-seq
MIRT2367281	hsa-miR-1207-5p	CLIP-seq
MIRT1487508	hsa-miR-1245b-5p	CLIP-seq
MIRT1487512	hsa-miR-21	CLIP-seq
MIRT1487513	hsa-miR-214	CLIP-seq
MIRT1487514	hsa-miR-23a	CLIP-seq
MIRT1487515	hsa-miR-23b	CLIP-seq
MIRT1487516	hsa-miR-23c	CLIP-seq
MIRT1487518	hsa-miR-3142	CLIP-seq
MIRT2367282	hsa-miR-3158-3p	CLIP-seq
MIRT1487520	hsa-miR-323-3p	CLIP-seq
MIRT1487522	hsa-miR-3619-5p	CLIP-seq
MIRT1487523	hsa-miR-3682-5p	CLIP-seq
MIRT1487527	hsa-miR-4273	CLIP-seq
MIRT1487531	hsa-miR-4650-5p	CLIP-seq
MIRT1487533	hsa-miR-4677-3p	CLIP-seq
MIRT1487534	hsa-miR-4677-5p	CLIP-seq
MIRT1487535	hsa-miR-4679	CLIP-seq
MIRT2367284	hsa-miR-4685-5p	CLIP-seq
MIRT1487537	hsa-miR-4690-5p	CLIP-seq
MIRT2367286	hsa-miR-4736	CLIP-seq
MIRT2367287	hsa-miR-4763-3p	CLIP-seq
MIRT1487541	hsa-miR-4777-5p	CLIP-seq
MIRT1487544	hsa-miR-518d-5p	CLIP-seq
MIRT1487545	hsa-miR-519b-5p	CLIP-seq
MIRT1487546	hsa-miR-519c-5p	CLIP-seq
MIRT1487547	hsa-miR-520c-5p	CLIP-seq
MIRT1487548	hsa-miR-526a	CLIP-seq
MIRT1487550	hsa-miR-579	CLIP-seq
MIRT1487551	hsa-miR-590-5p	CLIP-seq
MIRT1487552	hsa-miR-627	CLIP-seq
MIRT1487553	hsa-miR-761	CLIP-seq
MIRT2367281	hsa-miR-1207-5p	CLIP-seq
MIRT1487512	hsa-miR-21	CLIP-seq
MIRT2367282	hsa-miR-3158-3p	CLIP-seq
MIRT1487527	hsa-miR-4273	CLIP-seq
MIRT1487533	hsa-miR-4677-3p	CLIP-seq
MIRT1487534	hsa-miR-4677-5p	CLIP-seq
MIRT1487535	hsa-miR-4679	CLIP-seq
MIRT2367284	hsa-miR-4685-5p	CLIP-seq
MIRT2367286	hsa-miR-4736	CLIP-seq
MIRT2367287	hsa-miR-4763-3p	CLIP-seq
MIRT1487541	hsa-miR-4777-5p	CLIP-seq
MIRT1487544	hsa-miR-518d-5p	CLIP-seq
MIRT1487545	hsa-miR-519b-5p	CLIP-seq
MIRT1487546	hsa-miR-519c-5p	CLIP-seq
MIRT1487547	hsa-miR-520c-5p	CLIP-seq
MIRT1487548	hsa-miR-526a	CLIP-seq
MIRT1487551	hsa-miR-590-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0005515	Function	Protein binding	IPI	25609649, 33961781, 34819669
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007519	Process	Skeletal muscle tissue development	IGI	35140224
GO:0016740	Function	Transferase activity	IEA
GO:0019903	Function	Protein phosphatase binding	IDA	22572157
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0072542	Function	Protein phosphatase activator activity	IEA

MIM	HGNC	e!Ensembl
619771	18996	ENSG00000105053

Q8IV63

Protein name

Serine/threonine-protein kinase VRK3 (EC 2.7.11.22) (Vaccinia-related kinase 3)

Protein function

Plays a role in the regulation of the cell cycle by phosphorylating the nuclear envelope protein barrier-to-autointegration factor/BAF that is required for disassembly and reassembly, respectively, of the nuclear envelope during mitosis (PubMed:

PDB

2JII

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13240	zinc_ribbon_2	4 → 26	zinc-ribbon domain	Domain
PF00069	Pkinase	202 → 451	Protein kinase domain	Domain

Sequence

MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSP
KKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTR
GSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGIL
YEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLA
IPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHEN
EYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMD
LHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH
WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP

Sequence length

474

Interactions

View interactions

	Reactome
			ERKs are inactivated

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28927264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22095101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	31324890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28927264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27941812		★★★★★ ★☆☆☆☆ Found in Text Mining only

VRK3 (VRK serine/threonine kinase 3)