COPZ2 (coat protein complex I subunit zeta 2)

Gene

• Entrez ID: 51226
• Gene name: Coat protein complex I subunit zeta 2
• Gene symbol: COPZ2
• Synonyms (NCBI Gene): zeta2-COP
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: This gene encodes a member of the adaptor complexes small subunit family. The encoded protein is a subunit of the coatomer protein complex, a seven-subunit complex that functions in the formation of COPI-type, non-clathrin-coated vesicles. COPI vesicles f

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029575	hsa-miR-26b-5p	Microarray	19088304
MIRT2204024	hsa-miR-1202	CLIP-seq
MIRT2204025	hsa-miR-2110	CLIP-seq
MIRT2204026	hsa-miR-3150a-3p	CLIP-seq
MIRT2204027	hsa-miR-3972	CLIP-seq
MIRT2204028	hsa-miR-4271	CLIP-seq
MIRT2204029	hsa-miR-4725-3p	CLIP-seq
MIRT2204030	hsa-miR-4755-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005801	Component	Cis-Golgi network	NAS	11056392
GO:0005829	Component	Cytosol	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	NAS	11056392
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030126	Component	COPI vesicle coat	IBA
GO:0030126	Component	COPI vesicle coat	IDA	14729954
GO:0030126	Component	COPI vesicle coat	IEA
GO:0030126	Component	COPI vesicle coat	NAS	11056392
GO:0030133	Component	Transport vesicle	IEA
GO:0030133	Component	Transport vesicle	TAS
GO:0030663	Component	COPI-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA

Other IDs

• MIM: 615526
• HGNC: 19356
• e!Ensembl: ENSG00000005243

Protein

• UniProt ID: Q9P299
• Protein name: Coatomer subunit zeta-2 (Zeta-2-coat protein) (Zeta-2 COP)
• Protein function: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi ne
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01217	Clat_adaptor_s	45 → 185	Clathrin adaptor complex small chain	Domain

• Sequence:

  MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLL
  AKYYDDTFPSMKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENE
  LMLMSVLTCLFESLNHMLRKNVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVN
  FRADDGGLTEQSVAQVLQSAKEQIKWSLLK

• Sequence length: 210

Pathways

Reactome:

COPI-mediated anterograde transport
COPI-dependent Golgi-to-ER retrograde traffic

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21868754		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21868754		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21746916		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37355885	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40133516	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35127296	Associate	★☆☆☆☆ Found in Text Mining only