CLDN18 (claudin 18)

Gene

• Entrez ID: 51208
• Gene name: Claudin 18
• Gene symbol: CLDN18
• Synonyms (NCBI Gene): SFTA5, SFTPJ
• Chromosome: 3
• Chromosome location: 3q22.3
• Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053762	hsa-miR-1303	Luciferase reporter assay, qRT-PCR, Western blot	24647998
MIRT053762	hsa-miR-1303	Luciferase reporter assay, qRT-PCR, Western blot	24647998
MIRT895186	hsa-miR-1245	CLIP-seq
MIRT895187	hsa-miR-1285	CLIP-seq
MIRT895188	hsa-miR-3159	CLIP-seq
MIRT895189	hsa-miR-3187-5p	CLIP-seq
MIRT895190	hsa-miR-3667-3p	CLIP-seq
MIRT895191	hsa-miR-378g	CLIP-seq
MIRT895192	hsa-miR-4252	CLIP-seq
MIRT895193	hsa-miR-4314	CLIP-seq
MIRT895194	hsa-miR-4437	CLIP-seq
MIRT895195	hsa-miR-4438	CLIP-seq
MIRT895196	hsa-miR-4474-5p	CLIP-seq
MIRT895197	hsa-miR-4486	CLIP-seq
MIRT895198	hsa-miR-4674	CLIP-seq
MIRT895199	hsa-miR-4775	CLIP-seq
MIRT895200	hsa-miR-4777-5p	CLIP-seq
MIRT895201	hsa-miR-495	CLIP-seq
MIRT895202	hsa-miR-5095	CLIP-seq
MIRT895203	hsa-miR-590-3p	CLIP-seq
MIRT895204	hsa-miR-612	CLIP-seq
MIRT895205	hsa-miR-1184	CLIP-seq
MIRT895206	hsa-miR-1266	CLIP-seq
MIRT895207	hsa-miR-147	CLIP-seq
MIRT895208	hsa-miR-24	CLIP-seq
MIRT895209	hsa-miR-2681	CLIP-seq
MIRT895210	hsa-miR-3121-3p	CLIP-seq
MIRT895211	hsa-miR-3171	CLIP-seq
MIRT895212	hsa-miR-3650	CLIP-seq
MIRT895213	hsa-miR-3911	CLIP-seq
MIRT895214	hsa-miR-4270	CLIP-seq
MIRT895215	hsa-miR-4284	CLIP-seq
MIRT895216	hsa-miR-4292	CLIP-seq
MIRT895217	hsa-miR-4308	CLIP-seq
MIRT895218	hsa-miR-4323	CLIP-seq
MIRT895219	hsa-miR-4418	CLIP-seq
MIRT895220	hsa-miR-4441	CLIP-seq
MIRT895221	hsa-miR-4506	CLIP-seq
MIRT895222	hsa-miR-4518	CLIP-seq
MIRT895223	hsa-miR-4635	CLIP-seq
MIRT895224	hsa-miR-4747-5p	CLIP-seq
MIRT895225	hsa-miR-509-3-5p	CLIP-seq
MIRT895226	hsa-miR-509-5p	CLIP-seq
MIRT895227	hsa-miR-629	CLIP-seq
MIRT895228	hsa-miR-644	CLIP-seq
MIRT1965445	hsa-miR-122	CLIP-seq
MIRT895209	hsa-miR-2681	CLIP-seq
MIRT1965446	hsa-miR-3064-5p	CLIP-seq
MIRT1965447	hsa-miR-3135b	CLIP-seq
MIRT1965448	hsa-miR-3622a-3p	CLIP-seq
MIRT1965449	hsa-miR-3622b-3p	CLIP-seq
MIRT895212	hsa-miR-3650	CLIP-seq
MIRT1965450	hsa-miR-3652	CLIP-seq
MIRT1965451	hsa-miR-3670	CLIP-seq
MIRT1965452	hsa-miR-4430	CLIP-seq
MIRT1965453	hsa-miR-4505	CLIP-seq
MIRT895216	hsa-miR-4292	CLIP-seq
MIRT895217	hsa-miR-4308	CLIP-seq
MIRT895205	hsa-miR-1184	CLIP-seq
MIRT1965445	hsa-miR-122	CLIP-seq
MIRT895186	hsa-miR-1245	CLIP-seq
MIRT2201387	hsa-miR-1275	CLIP-seq
MIRT895208	hsa-miR-24	CLIP-seq
MIRT895209	hsa-miR-2681	CLIP-seq
MIRT1965446	hsa-miR-3064-5p	CLIP-seq
MIRT1965447	hsa-miR-3135b	CLIP-seq
MIRT2201388	hsa-miR-3150a-3p	CLIP-seq
MIRT2201389	hsa-miR-3175	CLIP-seq
MIRT2201390	hsa-miR-330-3p	CLIP-seq
MIRT1965448	hsa-miR-3622a-3p	CLIP-seq
MIRT1965449	hsa-miR-3622b-3p	CLIP-seq
MIRT895212	hsa-miR-3650	CLIP-seq
MIRT1965450	hsa-miR-3652	CLIP-seq
MIRT895191	hsa-miR-378g	CLIP-seq
MIRT2201391	hsa-miR-4259	CLIP-seq
MIRT895215	hsa-miR-4284	CLIP-seq
MIRT895216	hsa-miR-4292	CLIP-seq
MIRT895217	hsa-miR-4308	CLIP-seq
MIRT895218	hsa-miR-4323	CLIP-seq
MIRT895219	hsa-miR-4418	CLIP-seq
MIRT2201392	hsa-miR-4423-5p	CLIP-seq
MIRT1965452	hsa-miR-4430	CLIP-seq
MIRT895194	hsa-miR-4437	CLIP-seq
MIRT2201393	hsa-miR-4480	CLIP-seq
MIRT1965453	hsa-miR-4505	CLIP-seq
MIRT2201394	hsa-miR-4651	CLIP-seq
MIRT2201395	hsa-miR-4661-5p	CLIP-seq
MIRT2201396	hsa-miR-4662a-5p	CLIP-seq
MIRT2201397	hsa-miR-4665-5p	CLIP-seq
MIRT895198	hsa-miR-4674	CLIP-seq
MIRT2201398	hsa-miR-491-5p	CLIP-seq
MIRT895225	hsa-miR-509-3-5p	CLIP-seq
MIRT895226	hsa-miR-509-5p	CLIP-seq
MIRT2201399	hsa-miR-532-3p	CLIP-seq
MIRT2201400	hsa-miR-608	CLIP-seq
MIRT2201401	hsa-miR-939	CLIP-seq
MIRT895186	hsa-miR-1245	CLIP-seq
MIRT895218	hsa-miR-4323	CLIP-seq
MIRT2447141	hsa-miR-1276	CLIP-seq
MIRT2447142	hsa-miR-4328	CLIP-seq
MIRT2447143	hsa-miR-548aa	CLIP-seq
MIRT2201390	hsa-miR-330-3p	CLIP-seq
MIRT2504404	hsa-miR-4698	CLIP-seq
MIRT2504405	hsa-miR-4799-5p	CLIP-seq
MIRT2504406	hsa-miR-548p	CLIP-seq
MIRT2504404	hsa-miR-4698	CLIP-seq
MIRT2504405	hsa-miR-4799-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	19706394, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	ISS
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035265	Process	Organ growth	IEA
GO:0035265	Process	Organ growth	ISS
GO:0042045	Process	Epithelial fluid transport	IEA
GO:0042045	Process	Epithelial fluid transport	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048286	Process	Lung alveolus development	ISS
GO:0048565	Process	Digestive tract development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050673	Process	Epithelial cell proliferation	ISS
GO:0070160	Component	Tight junction	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0071391	Process	Cellular response to estrogen stimulus	IEA
GO:0071391	Process	Cellular response to estrogen stimulus	ISS
GO:0120193	Process	Tight junction organization	IEA
GO:0120193	Process	Tight junction organization	ISS
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	ISS
GO:2001205	Process	Negative regulation of osteoclast development	IEA

Other IDs

• MIM: 609210
• HGNC: 2039
• e!Ensembl: ENSG00000066405

Protein

• UniProt ID: P56856
• Protein name: Claudin-18
• Protein function: Involved in alveolar fluid homeostasis via regulation of alveolar epithelial tight junction composition and therefore ion transport and solute permeability, potentially via downstream regulation of the actin cytoskeleton organization and beta-2-
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	4 → 192	PMP-22/EMP/MP20/Claudin family	Family

• Tissue specificity: TISSUE SPECIFICITY: [Isoform A1]: Expression is restricted to the lung. {ECO:0000269|PubMed:19047087}.; TISSUE SPECIFICITY: [Isoform A2]: Expression is restricted to the stomach mucosa where it is predominantly observed in the epithelial cells of the pit
• Sequence:

  MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGF
  TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
  SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
  AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
  YDGGARTEDEVQSYPSKHDYV

• Sequence length: 261

Pathways

KEGG:

Virion - Hepatitis viruses
Cell adhesion molecules
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	18223320, 27527114, 30425335, 31235864		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18223320		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26919807, 29169410, 29400691, 29400695, 30325015, 30713254		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	21832145	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27215490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	17932229	Associate	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	28624624		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	40215597	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31332482		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	29894204		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	22864788		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	24787463		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21832145, 24333468	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18223320, 31332482		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18223320	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37438735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24710653		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18223320, 21832145	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34864774	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27884700, 37442189	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28624624		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	40215597	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18831034		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	LHGDN	18831034		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	35925388	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	21381080		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	21381080		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37621953	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30565710		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	40215597	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	22079592		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35925388	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32001212	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	35976638	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	30195448		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30349952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31332482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30565710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26919807		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18223320		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16435283, 16836752, 17459057, 19261089, 22005013, 24073219, 24647998, 26033320, 26146084, 27580354, 30195448, 30771244, 31332522		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19047087, 27527114, 28624624		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18477216, 24647998, 28624624, 30195448, 30425335, 30771244, 31332482		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24710653		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18223320		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18223320, 21832145	Associate	★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	19047087		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	19047087		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16435283, 16836752, 18251778, 18477216, 19261089, 22005013, 24073219, 24647998, 26033320, 26146084, 27580354, 30195448, 31332522		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16836752, 17459057, 19398608, 21832145, 24073219, 24333468, 27580354, 30361512, 30425335, 30771244, 31235864, 31332522, 32668412, 34864774, 35076580, 35811317, 35976638, 37949357, 40215597	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17459057		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18831034		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	18223320, 21832145	Associate	★☆☆☆☆ Found in Text Mining only