DUSP13B (dual specificity phosphatase 13B)

Gene

• Entrez ID: 51207
• Gene name: Dual specificity phosphatase 13B
• Gene symbol: DUSP13B
• Synonyms (NCBI Gene): DUSP13, MDSP, SKRP4, TMDP
• Chromosome: 10
• Chromosome location: 10q22.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0006470	Process	Protein dephosphorylation	TAS	10585869
GO:0007283	Process	Spermatogenesis	TAS	10585869
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IBA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS	10585869
GO:0016311	Process	Dephosphorylation	IDA	24531476
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IDA	24531476
GO:0016791	Function	Phosphatase activity	IEA
GO:0033549	Function	MAP kinase phosphatase activity	IBA
GO:0043409	Process	Negative regulation of MAPK cascade	IBA
GO:0051321	Process	Meiotic cell cycle	TAS	10585869

Other IDs

• MIM: 613191
• HGNC: 19681
• e!Ensembl: ENSG00000079393

Protein

• UniProt ID: Q9UII6
• Protein name: Dual specificity protein phosphatase 13B (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity phosphatase SKRP4) (Testis- and skeletal-muscle-specific DSP)
• Protein function: Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro (PubMed:21360282). Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific
• PDB: 2GWO, 2PQ5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00782	DSPc	53 → 190	Dual specificity phosphatase, catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the testis (at protein level) (PubMed:10585869, PubMed:15252030). Also found in the skeletal muscle (PubMed:15252030). {ECO:0000269|PubMed:10585869, ECO:0000269|PubMed:15252030}.
• Sequence:

  MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYA
  ARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVA
  RYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGF
  LRQLQVLDNRLGRETGRF

• Sequence length: 198

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations