GP6 (glycoprotein VI platelet)

Gene

• Entrez ID: 51206
• Gene name: Glycoprotein VI platelet
• Gene symbol: GP6
• Synonyms (NCBI Gene): BDPLT11, GPIV, GPVI
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a com

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028013	hsa-miR-3663-5p	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028017	hsa-miR-4312	CLIP-seq
MIRT1028018	hsa-miR-4423-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028021	hsa-miR-4635	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028027	hsa-miR-4757-5p	CLIP-seq
MIRT1028028	hsa-miR-4781-3p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT2004956	hsa-miR-128	CLIP-seq
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT2237639	hsa-miR-1273f	CLIP-seq
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT2237640	hsa-miR-219-2-3p	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT2237641	hsa-miR-3115	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT2237642	hsa-miR-342-5p	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028013	hsa-miR-3663-5p	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT2237643	hsa-miR-3675-5p	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028017	hsa-miR-4312	CLIP-seq
MIRT1028018	hsa-miR-4423-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028021	hsa-miR-4635	CLIP-seq
MIRT2237644	hsa-miR-4651	CLIP-seq
MIRT2237645	hsa-miR-4664-5p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028027	hsa-miR-4757-5p	CLIP-seq
MIRT1028028	hsa-miR-4781-3p	CLIP-seq
MIRT2237646	hsa-miR-608	CLIP-seq
MIRT2237647	hsa-miR-615-5p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Activation	12377757
FLI1	Activation	12359731
GATA1	Activation	12377757

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10822077
GO:0005515	Function	Protein binding	IPI	1715582, 19940238
GO:0005518	Function	Collagen binding	IEA
GO:0005518	Function	Collagen binding	TAS	9153205, 11027634
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10822077
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	TAS	9153205
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009986	Component	Cell surface	HDA	23382103
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030168	Process	Platelet activation	NAS	11027634
GO:0038023	Function	Signaling receptor activity	TAS	11027634
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038064	Function	Collagen receptor activity	IEA
GO:0038065	Process	Collagen-activated signaling pathway	IEA
GO:0038065	Process	Collagen-activated signaling pathway	TAS	31145836
GO:0045121	Component	Membrane raft	IDA	31145836
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070527	Process	Platelet aggregation	IEA
GO:0070527	Process	Platelet aggregation	IEA
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	18795891
GO:1901731	Process	Positive regulation of platelet aggregation	TAS	31145836
GO:1990782	Function	Protein tyrosine kinase binding	IPI	31145836

Other IDs

• MIM: 605546
• HGNC: 14388
• e!Ensembl: ENSG00000088053

Protein

• UniProt ID: Q9HCN6
• Protein name: Platelet glycoprotein VI (GPVI) (Glycoprotein 6)
• Protein function: Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous th
• PDB: 2GI7, 5OU7, 5OU8, 5OU9, 7NMU, 7R58
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	27 → 107	Immunoglobulin domain	Domain
  PF13895	Ig_2	113 → 202	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Megakaryocytes and platelets. {ECO:0000269|PubMed:10961879}.
• Sequence:

  MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
  KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP
  GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC
  YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT
  TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH
  RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS

• Sequence length: 339

Pathways

KEGG:

ECM-receptor interaction
Platelet activation

Reactome:

GPVI-mediated activation cascade
Cell surface interactions at the vascular wall
Platelet Adhesion to exposed collagen

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Platelet-type bleeding disorder 11	Pathogenic; Likely pathogenic	rs778336022, rs754929349, rs760074158, rs2146873791	RCV005361593 RCV002254221 RCV003148294 RCV000023461 RCV000023463	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Abnormal bleeding	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEEDING DIATHESIS DUE TO GLYCOPROTEIN VI DEFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEEDING DISORDER, PLATELET-TYPE, 11	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD PLATELET DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CORONARY THROMBOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOPROTEIN VI DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GP6-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Thyroid cancer, nonmedullary, 1	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON WILLEBRAND DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	31263257		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31165998		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32812532	Associate	★☆☆☆☆ Found in Text Mining only
Amegakaryocytic thrombocytopenia	Amegakaryocytic thrombocytopenia	BEFREE	18194481		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	34867780	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15277394		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23739280		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15277394		★☆☆☆☆ Found in Text Mining only
Bleeding diathesis due to glycoprotein VI deficiency	Bleeding Disorder	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	17910626, 19552682, 20680227, 23815599, 28704418, 29995658		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	15010364, 17690106, 18826391, 20526338, 20723028, 23168074, 23580446, 25645904, 26330203, 28300459, 30213874, 30545925, 30721642, 35041713, 35596611, 35955827, 36736831, 37302266	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	28004756	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	19686349	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32315343	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38143739	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19686349, 20723028, 23411630, 26330203	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20723028, 24553806, 26330203		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	28004756	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11323022		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23168074	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10339462, 22901552, 27753514, 31022936		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	12829582		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27416950		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32812532	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32655010	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22448969, 28953486		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16493486, 27848272		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10744142, 16493486, 27848272, 28607925		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17105818	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16493486, 27848272, 31783053		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17105818		★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	15306180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Thrombosis	Coronary Thrombosis	LHGDN	15306180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	22821001		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12540964, 15277394, 27999100		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12540964, 15277394, 27999100		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21854539	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33076381	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15277394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12540964, 12938014		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32315343	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	1703153		★☆☆☆☆ Found in Text Mining only
Glycoprotein VI deficiency	Glycoprotein VI Deficiency	CLINGEN_DG	10961879, 12515812, 12738669, 19549989, 19552682, 23815599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycoprotein VI deficiency	Glycoprotein VI Deficiency	UNIPROT_DG	19549989, 19552682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycoprotein VI deficiency	Glycoprotein VI Deficiency	ORPHANET_DG	19549989, 19552682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycoprotein VI deficiency	Glycoprotein VI Deficiency	GENOMICS_ENGLAND_DG	19549989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycoprotein VI deficiency	Glycoprotein VI Deficiency	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	15010364		★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	15010364	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22448969, 28953486		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28953486	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	12359731, 23815599, 28953486, 35596611	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	35041713	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27999100		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32833579	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	23168074	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17910626		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	15150079, 26330203, 29695020		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	19686349	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	12544734, 12871362, 23168074, 24553806, 31022936		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27416950, 29050501		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31351674		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	17910626		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	1715582	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25086789		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	39613182	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11053613		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	12829582		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10468872, 11571236, 15306180, 15874887, 17619827, 19786296, 22448969, 22627583, 24553806, 27753514		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	19686349, 20227257, 20723028, 25093390, 28004756	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	1703153, 21618514, 30952674		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	37302266	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30658193, 33147989	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33021140	Associate	★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	29050501		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23555315	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32440109	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23739280, 31244929, 31351674		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31683623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	29187378, 30597490, 31351674		★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	22821001, 22901851, 23168074, 28041267, 30278775		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	22431567		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	22821001, 22901851, 23168074, 28041267, 30278775		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	10339462, 19686349	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35041713	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	29985398		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	36736831	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Thrombosis	Thrombosis	Pubtator	17059472, 17690106, 18826391, 19459133, 19686349, 20227257, 22431567, 23815599, 30545925, 30721642, 32627625, 35561312, 35955827, 37302266, 38236412	Associate	★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	30978634		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36768853	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25743824	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	10468872	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19278955, 23150947, 27761580, 37537391	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	18349091	Associate	★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	14652648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
von Willebrand Disease Type 1	Von willebrand disorder	Pubtator	15226188	Associate	★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 1	von Willebrand disorder	BEFREE	14652648, 15226188		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 3	von Willebrand disorder	BEFREE	22431567		★☆☆☆☆ Found in Text Mining only