NUSAP1 (nucleolar and spindle associated protein 1)

Gene

• Entrez ID: 51203
• Gene name: Nucleolar and spindle associated protein 1
• Gene symbol: NUSAP1
• Synonyms (NCBI Gene): ANKT, BM037, LNP, NUSAP, PRO0310p1, Q0310, SAPL
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).[supplied by OMIM, Jun 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052111	hsa-let-7b-5p	CLASH	23622248
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200222	hsa-miR-186	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT1200224	hsa-miR-3662	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200227	hsa-miR-4733-5p	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT1200230	hsa-miR-548aa	CLIP-seq
MIRT1200231	hsa-miR-548ac	CLIP-seq
MIRT1200232	hsa-miR-548ae	CLIP-seq
MIRT1200233	hsa-miR-548aj	CLIP-seq
MIRT1200234	hsa-miR-548am	CLIP-seq
MIRT1200235	hsa-miR-548d-3p	CLIP-seq
MIRT1200236	hsa-miR-548x	CLIP-seq
MIRT1200237	hsa-miR-548z	CLIP-seq
MIRT1200238	hsa-miR-587	CLIP-seq
MIRT1200239	hsa-miR-10a	CLIP-seq
MIRT1200240	hsa-miR-10b	CLIP-seq
MIRT1200241	hsa-miR-1185	CLIP-seq
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200242	hsa-miR-128	CLIP-seq
MIRT1200243	hsa-miR-1285	CLIP-seq
MIRT1200244	hsa-miR-2277-3p	CLIP-seq
MIRT1200245	hsa-miR-3117-5p	CLIP-seq
MIRT1200246	hsa-miR-3120-3p	CLIP-seq
MIRT1200247	hsa-miR-3145-3p	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT1200248	hsa-miR-3187-5p	CLIP-seq
MIRT1200249	hsa-miR-339-5p	CLIP-seq
MIRT1200250	hsa-miR-3605-5p	CLIP-seq
MIRT1200251	hsa-miR-3613-3p	CLIP-seq
MIRT1200252	hsa-miR-3679-5p	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200253	hsa-miR-4275	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200255	hsa-miR-4421	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200256	hsa-miR-4524	CLIP-seq
MIRT1200257	hsa-miR-4666-5p	CLIP-seq
MIRT1200258	hsa-miR-4672	CLIP-seq
MIRT1200259	hsa-miR-4725-5p	CLIP-seq
MIRT1200260	hsa-miR-4786-5p	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT1200261	hsa-miR-504	CLIP-seq
MIRT1200262	hsa-miR-5096	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq
MIRT1200265	hsa-miR-545	CLIP-seq
MIRT1200266	hsa-miR-548a-3p	CLIP-seq
MIRT1200267	hsa-miR-548e	CLIP-seq
MIRT1200268	hsa-miR-548f	CLIP-seq
MIRT1200269	hsa-miR-548p	CLIP-seq
MIRT1200270	hsa-miR-593	CLIP-seq
MIRT1200271	hsa-miR-612	CLIP-seq
MIRT1200272	hsa-miR-661	CLIP-seq
MIRT1200273	hsa-miR-769-5p	CLIP-seq
MIRT1200274	hsa-miR-887	CLIP-seq
MIRT1200245	hsa-miR-3117-5p	CLIP-seq
MIRT2057999	hsa-miR-3156-5p	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT2058000	hsa-miR-3919	CLIP-seq
MIRT2058001	hsa-miR-3942-3p	CLIP-seq
MIRT1200256	hsa-miR-4524	CLIP-seq
MIRT1200258	hsa-miR-4672	CLIP-seq
MIRT2058002	hsa-miR-4756-3p	CLIP-seq
MIRT1200238	hsa-miR-587	CLIP-seq
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT2455567	hsa-miR-3976	CLIP-seq
MIRT2455568	hsa-miR-4693-3p	CLIP-seq
MIRT2455569	hsa-miR-4709-3p	CLIP-seq
MIRT2584291	hsa-miR-3148	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq
MIRT2584291	hsa-miR-3148	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IDA	12963707
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000281	Process	Mitotic cytokinesis	IDA	12963707
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	25416956, 39212774
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007076	Process	Mitotic chromosome condensation	IBA
GO:0007076	Process	Mitotic chromosome condensation	IDA	12963707
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0040001	Process	Establishment of mitotic spindle localization	IBA
GO:0040001	Process	Establishment of mitotic spindle localization	IDA	12963707
GO:0040001	Process	Establishment of mitotic spindle localization	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	12963707
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IBA
GO:0072686	Component	Mitotic spindle	IEA

Other IDs

• MIM: 612818
• HGNC: 18538
• e!Ensembl: ENSG00000137804

Protein

• UniProt ID: Q9BXS6
• Protein name: Nucleolar and spindle-associated protein 1 (NuSAP)
• Protein function: Microtubule-associated protein with the capacity to bundle and stabilize microtubules (By similarity). May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. {ECO:0000250, ECO:0000269|PubMed:1296
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16006	NUSAP	158 → 436	Nucleolar and spindle-associated protein	Family

• Sequence:

  MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTS
  ASSCDETEIQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHE
  KQESQDLRATAKVPSPPDEHQEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAI
  TTPNFKKLHEAHFKEMESIDQYIERKKKHFEEHNSMNELKQQPINKGGVRTPVPPRGRLS
  VASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKT
  PARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDL
  KASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ
  ERKEKKAKVLGMRRGLILAED

• Sequence length: 441

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Microcephaly, seizures, and developmental delay	Likely pathogenic	rs2140875089	RCV002255108	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Astrocytoma	Astrocytoma	BEFREE	28899410		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26485712, 30988805		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25756514, 26485712, 30476929, 31895772, 31901150, 32651974, 34384030, 36096037, 37713876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26554377, 31901150, 33126319	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31746405, 31901150, 32046048, 33784984, 34238253, 36882493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29541240, 31629809		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35739489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38229038	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30678687		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30678687		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27461786		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28957395, 29853313		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29853313		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	25944804		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28957395, 29608915		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	25944804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31469863	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27461786		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37005340	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	37005340	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28989042, 29995176		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30356407, 33423377	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28989042, 29995176		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29336114		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29336114	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	30476929		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37781040	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20053754	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20053754, 30480765	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30165047, 30458889, 30936967, 31001331		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35487972, 39980241	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35710427	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26485712, 30988805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30936967, 31516748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29541240, 31629809		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22349817, 25585568, 28404898, 30626528		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31710389		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27461786, 28899410, 29608915, 30678687		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30678687		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28957395, 29853313		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17611626, 37781040	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21157382	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33032291	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30926950		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30926950		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37005340	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22542825, 23756599, 26554377, 27461786, 28899410, 29336114, 30165047, 30458889, 30793360, 31710389		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31603257		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31729978, 35739489, 37304238	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32420375, 36401386	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22349817, 25585568, 28404898, 30626528		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22349817, 37047232	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27461786		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	37005340	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26554377		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30793360		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26554377, 33285674, 39980241	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31710389		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35710427	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	33025856, 33455115	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26485712, 29502423		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26485712	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31901150, 35487972	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23405241, 31901150	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30678687	Stimulate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	35485274	Associate	★☆☆☆☆ Found in Text Mining only