Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51182
Gene name	Heat shock protein family A (Hsp70) member 14
Gene symbol	HSPA14
Synonyms (NCBI Gene)	HSP70-4HSP70L1MSANTD7
Chromosome	10
Chromosome location	10p13

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002543	hsa-miR-373-3p	Microarray	15685193
MIRT048464	hsa-miR-100-5p	CLASH	23622248
MIRT046763	hsa-miR-222-3p	CLASH	23622248
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT645111	hsa-miR-7977	HITS-CLIP	23824327
MIRT631443	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT631442	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT631441	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT631440	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT631439	hsa-miR-4489	HITS-CLIP	23824327
MIRT631438	hsa-miR-4283	HITS-CLIP	23824327
MIRT631437	hsa-miR-185-3p	HITS-CLIP	23824327
MIRT631436	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT631435	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT631434	hsa-miR-4447	HITS-CLIP	23824327
MIRT631433	hsa-miR-4472	HITS-CLIP	23824327
MIRT631432	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT631431	hsa-miR-4633-5p	HITS-CLIP	23824327
MIRT631430	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT445443	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445449	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445448	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445447	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445446	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445445	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445444	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445443	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445442	hsa-miR-3163	PAR-CLIP	22100165
MIRT445441	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT445440	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT445439	hsa-miR-6083	PAR-CLIP	22100165
MIRT445451	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445449	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445448	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445447	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445446	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445445	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445444	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445443	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445442	hsa-miR-3163	PAR-CLIP	22100165
MIRT445441	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT445440	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT445439	hsa-miR-6083	PAR-CLIP	22100165
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT645111	hsa-miR-7977	HITS-CLIP	23824327
MIRT631443	hsa-miR-532-5p	HITS-CLIP	23824327
MIRT631442	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT631441	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT631440	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT631439	hsa-miR-4489	HITS-CLIP	23824327
MIRT631438	hsa-miR-4283	HITS-CLIP	23824327
MIRT631437	hsa-miR-185-3p	HITS-CLIP	23824327
MIRT631436	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT631435	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT631434	hsa-miR-4447	HITS-CLIP	23824327
MIRT631433	hsa-miR-4472	HITS-CLIP	23824327
MIRT631432	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT631431	hsa-miR-4633-5p	HITS-CLIP	23824327
MIRT631430	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT445449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT445448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT445447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT445446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT445445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT445444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT445443	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT445451	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445449	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445448	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445447	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445446	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445445	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445444	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445443	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445442	hsa-miR-3163	PAR-CLIP	22100165
MIRT445441	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT445440	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT445439	hsa-miR-6083	PAR-CLIP	22100165
MIRT445451	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445449	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445448	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445447	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445446	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445445	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445444	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445443	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445442	hsa-miR-3163	PAR-CLIP	22100165
MIRT445441	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT445440	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT445439	hsa-miR-6083	PAR-CLIP	22100165
MIRT1056061	hsa-miR-3591-3p	CLIP-seq
MIRT1056062	hsa-miR-374c	CLIP-seq
MIRT1056063	hsa-miR-4731-3p	CLIP-seq
MIRT1056064	hsa-miR-4789-5p	CLIP-seq
MIRT1056065	hsa-miR-4801	CLIP-seq
MIRT1056066	hsa-miR-548aa	CLIP-seq
MIRT1056067	hsa-miR-548l	CLIP-seq
MIRT1056068	hsa-miR-655	CLIP-seq
MIRT1056061	hsa-miR-3591-3p	CLIP-seq
MIRT1056062	hsa-miR-374c	CLIP-seq
MIRT2012885	hsa-miR-409-3p	CLIP-seq
MIRT1056063	hsa-miR-4731-3p	CLIP-seq
MIRT1056064	hsa-miR-4789-5p	CLIP-seq
MIRT1056065	hsa-miR-4801	CLIP-seq
MIRT1056066	hsa-miR-548aa	CLIP-seq
MIRT1056067	hsa-miR-548l	CLIP-seq
MIRT2012886	hsa-miR-548n	CLIP-seq
MIRT2012887	hsa-miR-582-5p	CLIP-seq
MIRT1056068	hsa-miR-655	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	16002468, 28514442, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	16002468, 21231916
GO:0005829	Component	Cytosol	IEA
GO:0005840	Component	Ribosome	IBA
GO:0005840	Component	Ribosome	IDA	16002468
GO:0005886	Component	Plasma membrane	IBA
GO:0006457	Process	Protein folding	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0031072	Function	Heat shock protein binding	IBA
GO:0042026	Process	Protein refolding	IBA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0051083	Process	'de novo' cotranslational protein folding	TAS	16002468
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA

MIM	HGNC	e!Ensembl
610369	29526	ENSG00000187522

Q0VDF9

Protein name

Heat shock 70 kDa protein 14 (HSP70-like protein 1) (Heat shock protein HSP60) (Heat shock protein family A member 14)

Protein function

Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase ac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00012	HSP70	3 → 509	Hsp70 protein	Family

Sequence

MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNI
SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI
FSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAY
GIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLA
SEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNS
IPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVL
TMKRDGSLHVTCTDQETGKCEAISIEIAS

Sequence length

509

Interactions

View interactions

	Reactome
			Regulation of HSF1-mediated heat shock response

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MOUTH DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (113)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	1352969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14963017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	29766408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21473952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19772795, 7905462, 9705246		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16218479, 20609438, 24347824, 25395618, 26477505, 26786003, 27712463, 28638138, 28667536, 29107690, 29134442, 29151033, 8678928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	1316935, 14643638, 23376792, 25904550, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30340651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10701837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16218479, 20609438, 24347824, 25395618, 26477505, 26786003, 27712463, 28638138, 28667536, 29107690, 29134442, 29151033, 8678928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10047432, 11086048, 12414951, 12421990, 12791317, 16218479, 19207939, 27899808, 28181533, 29177667, 31658770, 8671607, 8678928, 8799697, 9021358, 9239521 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11600199, 15654837, 28276957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25891376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30337218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23807299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39828281	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	39828281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21785448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25798051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18372523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23429486, 31477750, 8098058, 8100743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29151033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24347824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22140545, 28976240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31658770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18229457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18229457, 30669938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15893396, 16602628, 18229457, 18320357, 30093913, 30746790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	14643002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27118120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11086048, 12421990, 15952088, 18229457, 29134442, 7589082, 9790880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11086048, 12421990, 15952088, 18229457, 29134442, 7589082, 9790880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10047432, 12791317, 9790880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15952088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	7589082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12515899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	31188484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	20138216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	7672143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	8098058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22487187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14663101, 15583145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	19109937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29616680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	8799697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	31762598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	31589899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30802639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29134442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31321561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30800066, 31717769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30800066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	1316935, 16807696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Hypomyelinating, 4	Leukodystrophy	BEFREE	19706612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29672920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	29616680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33225964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23429486, 31477750, 8100743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16705742, 31426412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15880780, 18086682, 20351780, 21785448, 26672742, 27345726, 28525768, 28774748, 29177667, 29415987, 30609639, 31112866, 31673102, 31772283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26672742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30614112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	10714591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	24738046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth Diseases	CTD_human_DG	17682004		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	19950419, 31024869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	31317194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	14663101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	1374907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31109132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14500649, 17905417, 18086682, 21785448, 22487187, 23807299, 23839491, 25207654, 28617974, 29415987, 31477750, 8098058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22012253, 30609639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23339303, 28586011, 29732373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28178129, 31305682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24084737, 27899808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	29024428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27118120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19306954, 30224697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8100743		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23429486, 31477750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29415987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24123003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25058444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11953387, 19109937, 25058444, 28667536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	29293508		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	29293508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	16807696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	30635080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16705742, 31426412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27864821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	11985522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31112866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	28196897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	24738046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17925998, 19565483, 27160252, 30465159, 31727095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25891376		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	26759119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	11898127, 18400758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21441812, 22297444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31744495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSPA14 (heat shock protein family A (Hsp70) member 14)