Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51177
Gene name	Pleckstrin homology domain containing O1
Gene symbol	PLEKHO1
Synonyms (NCBI Gene)	CKIP-1CKIP1JBPOC120
Chromosome	1
Chromosome location	1q21.2

170

Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045557	hsa-miR-149-5p	CLASH	23622248
MIRT045557	hsa-miR-149-5p	CLASH	23622248
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT679959	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT498125	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT498124	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT498123	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT498122	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT498121	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT498120	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT498119	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT498118	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT498117	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT498116	hsa-miR-4458	PAR-CLIP	20371350
MIRT498115	hsa-miR-4500	PAR-CLIP	20371350
MIRT498114	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT498113	hsa-miR-5692a	PAR-CLIP	20371350
MIRT498111	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT535140	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT535139	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT535138	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT535137	hsa-miR-610	PAR-CLIP	22012620
MIRT535136	hsa-miR-4268	PAR-CLIP	22012620
MIRT535135	hsa-miR-4448	PAR-CLIP	22012620
MIRT535134	hsa-miR-4284	PAR-CLIP	22012620
MIRT535133	hsa-miR-6772-3p	PAR-CLIP	22012620
MIRT498125	hsa-let-7b-5p	PAR-CLIP	22291592
MIRT498124	hsa-let-7c-5p	PAR-CLIP	22291592
MIRT498123	hsa-let-7a-5p	PAR-CLIP	22291592
MIRT498122	hsa-let-7e-5p	PAR-CLIP	22291592
MIRT498121	hsa-let-7f-5p	PAR-CLIP	22291592
MIRT498120	hsa-let-7g-5p	PAR-CLIP	22291592
MIRT498119	hsa-let-7i-5p	PAR-CLIP	22291592
MIRT498118	hsa-let-7d-5p	PAR-CLIP	22291592
MIRT498117	hsa-miR-98-5p	PAR-CLIP	22291592
MIRT498116	hsa-miR-4458	PAR-CLIP	22291592
MIRT498115	hsa-miR-4500	PAR-CLIP	22291592
MIRT498114	hsa-miR-129-5p	PAR-CLIP	22291592
MIRT498113	hsa-miR-5692a	PAR-CLIP	22291592
MIRT498112	hsa-miR-5586-5p	PAR-CLIP	22291592
MIRT498111	hsa-miR-202-3p	PAR-CLIP	22291592
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT679959	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT622703	hsa-miR-8062	HITS-CLIP	23824327
MIRT622702	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622701	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622700	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622699	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622698	hsa-miR-1976	HITS-CLIP	23824327
MIRT622697	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622696	hsa-miR-4279	HITS-CLIP	23824327
MIRT498125	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT498124	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT498123	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT498122	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT498121	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT498120	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT498119	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT498118	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT498117	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT498116	hsa-miR-4458	PAR-CLIP	20371350
MIRT498115	hsa-miR-4500	PAR-CLIP	20371350
MIRT498114	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT498113	hsa-miR-5692a	PAR-CLIP	20371350
MIRT498111	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT535140	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT535139	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT535138	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT535137	hsa-miR-610	PAR-CLIP	22012620
MIRT535136	hsa-miR-4268	PAR-CLIP	22012620
MIRT535135	hsa-miR-4448	PAR-CLIP	22012620
MIRT535134	hsa-miR-4284	PAR-CLIP	22012620
MIRT535133	hsa-miR-6772-3p	PAR-CLIP	22012620
MIRT498125	hsa-let-7b-5p	PAR-CLIP	22291592
MIRT498124	hsa-let-7c-5p	PAR-CLIP	22291592
MIRT498123	hsa-let-7a-5p	PAR-CLIP	22291592
MIRT498122	hsa-let-7e-5p	PAR-CLIP	22291592
MIRT498121	hsa-let-7f-5p	PAR-CLIP	22291592
MIRT498120	hsa-let-7g-5p	PAR-CLIP	22291592
MIRT498119	hsa-let-7i-5p	PAR-CLIP	22291592
MIRT498118	hsa-let-7d-5p	PAR-CLIP	22291592
MIRT498117	hsa-miR-98-5p	PAR-CLIP	22291592
MIRT498116	hsa-miR-4458	PAR-CLIP	22291592
MIRT498115	hsa-miR-4500	PAR-CLIP	22291592
MIRT498114	hsa-miR-129-5p	PAR-CLIP	22291592
MIRT498113	hsa-miR-5692a	PAR-CLIP	22291592
MIRT498112	hsa-miR-5586-5p	PAR-CLIP	22291592
MIRT498111	hsa-miR-202-3p	PAR-CLIP	22291592
MIRT2071651	hsa-miR-338-3p	CLIP-seq
MIRT2071652	hsa-miR-4530	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20580715, 21382345, 23032291, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007520	Process	Myoblast fusion	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0016020	Component	Membrane	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IEA
GO:0036195	Component	Muscle cell projection membrane	IBA
GO:0036195	Component	Muscle cell projection membrane	IEA
GO:0051451	Process	Myoblast migration	IEA
GO:0072673	Process	Lamellipodium morphogenesis	IEA
GO:1901739	Process	Regulation of myoblast fusion	IBA

MIM	HGNC	e!Ensembl
608335	24310	ENSG00000023902

Q53GL0

Protein name

Pleckstrin homology domain-containing family O member 1 (PH domain-containing family O member 1) (C-Jun-binding protein) (JBP) (Casein kinase 2-interacting protein 1) (CK2-interacting protein 1) (CKIP-1) (Osteoclast maturation-associated gene 120 protein)

Protein function

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein

PDB

3AA1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	22 → 132	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in skeletal muscle and heart, moderately in kidney, liver, brain and placenta and sparingly in the pancreas and lung. Easily detectable in cell lines such as MOLT-4, HEK293 and Jurkat. {ECO:0000269|PubMed:17197158}

Sequence

MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEV
KDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEK
ESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTST
SDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSL
SRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALP
NPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLG
EASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM

Sequence length

409

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	30683852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30824383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30683852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	31355268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25966172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	28402261	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28402261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37843347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32859214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28402261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28402261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28286065, 29248720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28351752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31355268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31355268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28402261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26979459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28402261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25966172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27840970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	27840970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	27840970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25966172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28881724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27840970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31201843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17942896, 25966172, 27840970, 31180521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29956799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28083909, 28128304, 29682283, 31082489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15831458, 27840970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	15831458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28286065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28286065, 29248720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28286065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30341484, 30824383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28212865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28351752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28881724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31868807	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32223671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLEKHO1 (pleckstrin homology domain containing O1)