Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51170
Gene name	Hydroxysteroid 17-beta dehydrogenase 11
Gene symbol	HSD17B11
Synonyms (NCBI Gene)	17-BETA-HSD1117-BETA-HSDXI17BHSD11DHRS8PAN1BRETSDR2SDR16C2
Chromosome	4
Chromosome location	4q22.1
Summary	Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023862	hsa-miR-1-3p	Proteomics	18668040
MIRT029679	hsa-miR-26b-5p	Microarray	19088304
MIRT2389196	hsa-miR-3913-3p	CLIP-seq
MIRT2389197	hsa-miR-4714-3p	CLIP-seq
MIRT2389198	hsa-miR-489	CLIP-seq
MIRT2389199	hsa-miR-490-3p	CLIP-seq
MIRT2547896	hsa-miR-1206	CLIP-seq
MIRT2547897	hsa-miR-205	CLIP-seq
MIRT2547898	hsa-miR-28-3p	CLIP-seq
MIRT2547899	hsa-miR-3145-3p	CLIP-seq
MIRT2547900	hsa-miR-3185	CLIP-seq
MIRT2547901	hsa-miR-3611	CLIP-seq
MIRT2547902	hsa-miR-3613-3p	CLIP-seq
MIRT2547903	hsa-miR-3662	CLIP-seq
MIRT2547904	hsa-miR-371b-5p	CLIP-seq
MIRT2389196	hsa-miR-3913-3p	CLIP-seq
MIRT2547905	hsa-miR-4289	CLIP-seq
MIRT2547906	hsa-miR-4328	CLIP-seq
MIRT2547907	hsa-miR-433	CLIP-seq
MIRT2547908	hsa-miR-4450	CLIP-seq
MIRT2547909	hsa-miR-4461	CLIP-seq
MIRT2547910	hsa-miR-4490	CLIP-seq
MIRT2547911	hsa-miR-4540	CLIP-seq
MIRT2547912	hsa-miR-4693-3p	CLIP-seq
MIRT2547913	hsa-miR-4709-3p	CLIP-seq
MIRT2389197	hsa-miR-4714-3p	CLIP-seq
MIRT2389198	hsa-miR-489	CLIP-seq
MIRT2389199	hsa-miR-490-3p	CLIP-seq
MIRT2547914	hsa-miR-579	CLIP-seq
MIRT2547915	hsa-miR-660	CLIP-seq
MIRT2547916	hsa-miR-664	CLIP-seq
MIRT2547896	hsa-miR-1206	CLIP-seq
MIRT2547898	hsa-miR-28-3p	CLIP-seq
MIRT2547899	hsa-miR-3145-3p	CLIP-seq
MIRT2547900	hsa-miR-3185	CLIP-seq
MIRT2547901	hsa-miR-3611	CLIP-seq
MIRT2547902	hsa-miR-3613-3p	CLIP-seq
MIRT2547903	hsa-miR-3662	CLIP-seq
MIRT2547904	hsa-miR-371b-5p	CLIP-seq
MIRT2389196	hsa-miR-3913-3p	CLIP-seq
MIRT2547905	hsa-miR-4289	CLIP-seq
MIRT2547907	hsa-miR-433	CLIP-seq
MIRT2547908	hsa-miR-4450	CLIP-seq
MIRT2547909	hsa-miR-4461	CLIP-seq
MIRT2547912	hsa-miR-4693-3p	CLIP-seq
MIRT2547913	hsa-miR-4709-3p	CLIP-seq
MIRT2389197	hsa-miR-4714-3p	CLIP-seq
MIRT2389198	hsa-miR-489	CLIP-seq
MIRT2389199	hsa-miR-490-3p	CLIP-seq
MIRT2547915	hsa-miR-660	CLIP-seq
MIRT2547916	hsa-miR-664	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CEBPA	Activation	21549806
SP1	Activation	21549806

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IDA	12697717
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	12697717
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IDA	14741744
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006703	Process	Estrogen biosynthetic process	TAS
GO:0006710	Process	Androgen catabolic process	IDA	12697717
GO:0016229	Function	Steroid dehydrogenase activity	IBA
GO:0016229	Function	Steroid dehydrogenase activity	IDA	12697717
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA

MIM	HGNC	e!Ensembl
612831	22960	ENSG00000198189

Q8NBQ5

Protein name

Estradiol 17-beta-dehydrogenase 11 (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase 11) (17-beta-HSD 11) (17bHSD11) (17betaHSD11) (17-beta-hydroxysteroid dehydrogenase XI) (17-beta-HSD XI) (17betaHSDXI) (Cutaneous T-cell lymphoma-associated antigen HD-

Protein function

Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by ge

PDB

1YB1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	37 → 233	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini o

Sequence

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLK
SKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNN
AGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVP
FLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPE
EVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ

Sequence length

300

Interactions

View interactions

	KEGG		Reactome
	Steroid hormone biosynthesis Metabolic pathways		Estrogen biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Coronary Artery Disease	Coronary artery disease	Pubtator	31881747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21549806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21549806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21549806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	33021790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HSD17B11 (hydroxysteroid 17-beta dehydrogenase 11)