Gene Gene information from NCBI Gene database.
Entrez ID 51157
Gene name Zinc finger protein 580
Gene symbol ZNF580
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.42
miRNA miRNA information provided by mirtarbase database.
165
miRTarBase ID miRNA Experiments Reference
MIRT1530524 hsa-miR-1 CLIP-seq
MIRT1530525 hsa-miR-1207-3p CLIP-seq
MIRT1530526 hsa-miR-122 CLIP-seq
MIRT1530527 hsa-miR-1252 CLIP-seq
MIRT1530528 hsa-miR-1321 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 20382120
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617888 29473 ENSG00000213015
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UK33
Protein name Zinc finger protein 580 (LDL-induced EC protein)
Protein function Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 120 142 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 150 172 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in endothelial cells. {ECO:0000269|PubMed:21599657}.
Sequence
MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANG
VPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATH
RARAGPPHTCPLCPRRFQDAAELAQHVRLH
Sequence length 172
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 36524545 Associate
★☆☆☆☆
Found in Text Mining only
Microvascular Angina Microvascular angina Pubtator 36524545 Associate
★☆☆☆☆
Found in Text Mining only
Septicemia Septicemia BEFREE 30386182
★☆☆☆☆
Found in Text Mining only