SDF4 (stromal cell derived factor 4)

Gene

• Entrez ID: 51150
• Gene name: Stromal cell derived factor 4
• Gene symbol: SDF4
• Synonyms (NCBI Gene): Cab45, SDF-4
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium de

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043980	hsa-miR-378a-5p	CLASH	23622248
MIRT042088	hsa-miR-484	CLASH	23622248
MIRT461032	hsa-miR-9500	PAR-CLIP	23592263
MIRT461031	hsa-miR-6134	PAR-CLIP	23592263
MIRT461030	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT461029	hsa-miR-4767	PAR-CLIP	23592263
MIRT461028	hsa-miR-6077	PAR-CLIP	23592263
MIRT461027	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT461025	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT461026	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT461024	hsa-miR-663a	PAR-CLIP	23592263
MIRT461023	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT461022	hsa-miR-615-5p	PAR-CLIP	23592263
MIRT461021	hsa-miR-7704	PAR-CLIP	23592263
MIRT461020	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT461019	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT461018	hsa-miR-4497	PAR-CLIP	23592263
MIRT439695	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439695	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT461032	hsa-miR-9500	PAR-CLIP	23592263
MIRT461031	hsa-miR-6134	PAR-CLIP	23592263
MIRT461030	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT461029	hsa-miR-4767	PAR-CLIP	23592263
MIRT461028	hsa-miR-6077	PAR-CLIP	23592263
MIRT461027	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT461025	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT461026	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT461024	hsa-miR-663a	PAR-CLIP	23592263
MIRT461023	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT461022	hsa-miR-615-5p	PAR-CLIP	23592263
MIRT461021	hsa-miR-7704	PAR-CLIP	23592263
MIRT461020	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT461019	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT461018	hsa-miR-4497	PAR-CLIP	23592263
MIRT1331713	hsa-miR-1273f	CLIP-seq
MIRT1331714	hsa-miR-1293	CLIP-seq
MIRT1331715	hsa-miR-143	CLIP-seq
MIRT1331716	hsa-miR-1538	CLIP-seq
MIRT1331717	hsa-miR-33a	CLIP-seq
MIRT1331718	hsa-miR-33b	CLIP-seq
MIRT1331719	hsa-miR-3649	CLIP-seq
MIRT1331720	hsa-miR-3661	CLIP-seq
MIRT1331721	hsa-miR-4330	CLIP-seq
MIRT1331722	hsa-miR-4483	CLIP-seq
MIRT1331723	hsa-miR-4533	CLIP-seq
MIRT1331724	hsa-miR-4690-3p	CLIP-seq
MIRT1331725	hsa-miR-4708-5p	CLIP-seq
MIRT1331726	hsa-miR-4734	CLIP-seq
MIRT1331727	hsa-miR-4745-3p	CLIP-seq
MIRT1331728	hsa-miR-4747-3p	CLIP-seq
MIRT1331729	hsa-miR-4747-5p	CLIP-seq
MIRT1331730	hsa-miR-4755-3p	CLIP-seq
MIRT1331731	hsa-miR-4770	CLIP-seq
MIRT1331732	hsa-miR-492	CLIP-seq
MIRT1331733	hsa-miR-631	CLIP-seq
MIRT1331734	hsa-miR-744	CLIP-seq
MIRT1331735	hsa-miR-941	CLIP-seq
MIRT2098030	hsa-miR-1343	CLIP-seq
MIRT1331716	hsa-miR-1538	CLIP-seq
MIRT2098031	hsa-miR-331-3p	CLIP-seq
MIRT1331723	hsa-miR-4533	CLIP-seq
MIRT2098032	hsa-miR-4539	CLIP-seq
MIRT1331727	hsa-miR-4745-3p	CLIP-seq
MIRT1331728	hsa-miR-4747-3p	CLIP-seq
MIRT1331729	hsa-miR-4747-5p	CLIP-seq
MIRT1331730	hsa-miR-4755-3p	CLIP-seq
MIRT2098033	hsa-miR-4794	CLIP-seq
MIRT1331735	hsa-miR-941	CLIP-seq
MIRT2098030	hsa-miR-1343	CLIP-seq
MIRT2098031	hsa-miR-331-3p	CLIP-seq
MIRT2098032	hsa-miR-4539	CLIP-seq
MIRT2098030	hsa-miR-1343	CLIP-seq
MIRT2098031	hsa-miR-331-3p	CLIP-seq
MIRT2098032	hsa-miR-4539	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	17442889
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	17442889, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	17442889
GO:0005770	Component	Late endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS	17442889
GO:0006887	Process	Exocytosis	IEA
GO:0009650	Process	UV protection	ISS	18355758
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	IBA
GO:0017156	Process	Calcium-ion regulated exocytosis	ISS	17442889
GO:0021549	Process	Cerebellum development	ISS	18355758
GO:0032059	Component	Bleb	IEA
GO:0042802	Function	Identical protein binding	ISS	17442889
GO:0042995	Component	Cell projection	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045471	Process	Response to ethanol	ISS	18355758
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070625	Process	Zymogen granule exocytosis	ISS	17442889
GO:0099558	Process	Maintenance of synapse structure	IGI	33667157

Other IDs

• MIM: 614282
• HGNC: 24188
• e!Ensembl: ENSG00000078808

Protein

• UniProt ID: Q9BRK5
• Protein name: 45 kDa calcium-binding protein (Cab45) (Stromal cell-derived factor 4) (SDF-4)
• Protein function: May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. ; Isoform 5 may be involved in the exocytosis of zymogens by pancreatic acini.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	90 → 167	EF-hand domain pair	Domain
  PF13202	EF-hand_5	288 → 307	EF hand	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Isoform 5 is expressed in pancreas. {ECO:0000269|PubMed:17442889}.
• Sequence:

  MVWPWVAMASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPD
  HLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISA
  KEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADA
  IRLNEELKVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKE
  IVRDLDQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
  EELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHE
  EF

• Sequence length: 362

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30213243		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	8864572		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	9237482		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30710272		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21418345		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11875708, 19513569, 21195708, 23000163, 2448309, 9481475		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19513569	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25394367		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	15336963		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21029254		★☆☆☆☆ Found in Text Mining only
Classical galactosemia	Galactosemia	BEFREE	19952866		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21685359, 21795396		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21629658		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11734338		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	3436044		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17620096		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	17620096		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	17620096		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28130181, 29499206		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28130181, 29499206		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10052680		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28530639		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22483853		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17620096		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22915645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11875708, 19513569, 21195708, 23000163, 2448309, 9481475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25394367		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15946661, 18350635, 19376121		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11522620, 17219414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25266115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25744544		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19917604, 22694938, 9703888		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21685359, 21795396		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20587415		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30319357		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	10052680		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36606322	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11875708, 12859951, 21413873, 24706307		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	2140897		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29733516		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24706307		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15946661, 18350635, 19376121		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16215274	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	18452188		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29301628		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11522620, 17219414		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17620096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11734338		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	8780893		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21743468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	22269161		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29257295		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	18320059, 28393239		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25266115		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	18346207		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25744544		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25744544		★☆☆☆☆ Found in Text Mining only