Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51147
Gene name	Inhibitor of growth family member 4
Gene symbol	ING4
Synonyms (NCBI Gene)	my036p29ING4
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its

136

Show/Hide all (136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000448	hsa-miR-650	Luciferase reporter assayqRT-PCRWestern blot	20381459
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT017117	hsa-miR-335-5p	Microarray	18185580
MIRT000448	hsa-miR-650	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23991130
MIRT000448	hsa-miR-650	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23991130
MIRT737063	hsa-miR-18a-5p	Luciferase reporter assayImmunofluorescence	31724220
MIRT1066296	hsa-miR-1913	CLIP-seq
MIRT1066297	hsa-miR-3190	CLIP-seq
MIRT1066298	hsa-miR-324-3p	CLIP-seq
MIRT1066299	hsa-miR-3673	CLIP-seq
MIRT1066300	hsa-miR-3691-3p	CLIP-seq
MIRT1066301	hsa-miR-4301	CLIP-seq
MIRT1066302	hsa-miR-4491	CLIP-seq
MIRT1066303	hsa-miR-4657	CLIP-seq
MIRT1066304	hsa-miR-4738-3p	CLIP-seq
MIRT1066305	hsa-miR-4764-5p	CLIP-seq
MIRT1066306	hsa-miR-548g	CLIP-seq
MIRT1066307	hsa-miR-7	CLIP-seq
MIRT1066308	hsa-miR-892a	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551929	hsa-miR-1252	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551955	hsa-miR-4446-3p	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551961	hsa-miR-4656	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551967	hsa-miR-4721	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Activation	17956589

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IDA	16387653
GO:0001558	Process	Regulation of cell growth	IDA	22144582
GO:0001558	Process	Regulation of cell growth	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	16387653
GO:0005515	Function	Protein binding	IPI	12750254, 15029197, 17157298, 20211142, 23603392, 24981860, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15029197
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	16387653
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	22144582
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006473	Process	Protein acetylation	IDA	12750254
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12750254, 15251430
GO:0036408	Function	Histone H3K14 acetyltransferase activity	IDA	16387653
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IDA	15251430
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15029197
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045926	Process	Negative regulation of growth	IDA	12750254
GO:0046872	Function	Metal ion binding	IEA
GO:0046972	Function	Histone H4K16 acetyltransferase activity	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IDA	16387653
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	16728974
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IDA	16387653
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IEA
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IDA	15251430
GO:2000278	Process	Regulation of DNA biosynthetic process	IDA	16387653

MIM	HGNC	e!Ensembl
608524	19423	ENSG00000111653

Q9UNL4

Protein name

Inhibitor of growth protein 4 (p29ING4)

Protein function

Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4 (PubMed:16387653). Through chromatin acetylation it may function in DNA replication (PubMed:1638

PDB

2K1J , 2M1R , 2PNX , 2VNF , 4AFL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12998	ING	6 → 107	Inhibitor of growth proteins N-terminal histone-binding	Coiled-coil

Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS
VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP
RCSQERKKK

Sequence length

249

Interactions

View interactions

	Reactome
			HATs acetylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (94)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	18399550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18399550, 19034511, 22460125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19775294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19775294	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25790869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15029197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23684856	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15528276, 20501848, 20707719, 21315418, 23056468, 25792601, 26530780, 29489009, 31724215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20716169, 21315418	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23056468, 25792601, 34871062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16973615, 23967213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27421660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25790869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20716169, 21660060, 31059086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	22228137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22228137, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27466989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27466989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29516674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23055189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23055189, 26045800, 26936485, 27806345, 30008936, 31724220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	27806345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21626442, 23055189	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	27806345		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28781682, 30390334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19430401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30667053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	18375955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22228137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	19479822, 20716169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15029197, 17363573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15029197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17363573	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15029197, 17363573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19479822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19571607, 20066899, 20716169, 27471108, 28407709, 28927128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20716169, 23684856	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15935570, 20131318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	15935570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19250543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	23991130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21052098, 21988227, 22767438, 27421660, 28050784, 28925992, 30745827, 31849466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31849466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20716169	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	31420607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20716169, 21626442, 23055189	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	27806345		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28781682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15935570, 20131318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15528276, 20501848, 21315418, 23056468, 25792601, 26530780, 29489009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28781682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20716169, 31059086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22228137, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22075380, 30403588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24762396, 27527891, 31773467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20381459, 26564429, 29496496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25790869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15528276, 15738650, 19034511, 19250543, 20705953, 21660060, 21988227, 23604125, 25571952, 25790869, 25792601, 26530780, 26564429, 26803518, 27466989 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27466989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23055189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15528276, 23056468, 29489009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15528276		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18375955, 19430401, 21056991, 24130172, 24157826, 29207034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23028750, 24157826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23684856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17848618, 20066899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17848618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25005773, 25571952, 27421660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27421660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15528276, 15738650, 15935570, 16973615, 17363573, 17848618, 18399550, 18779315, 19034511, 19250543, 19409049, 19430401, 19479822, 19571607, 19775294 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21660060, 22863759, 31611970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24750000, 25326586, 25490312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25490312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22228137		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22228137, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27349517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19409049, 22075380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34268979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24762396, 27527891, 31773467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24762396, 27527891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27527891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19250543, 26022899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28781682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30390334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31239073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	23181555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	26022899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15935570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17363573	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19479822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17363573, 21310648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20381459, 24057236, 26564429, 29496496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19479822, 20716169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27466989	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

ING4 (inhibitor of growth family member 4)