Gene Gene information from NCBI Gene database.
Entrez ID 51134
Gene name Centrosomal protein 83
Gene symbol CEP83
Synonyms (NCBI Gene)
CCDC41NPHP18NY-REN-58
Chromosome 12
Chromosome location 12q22
Summary The protein encoded by this gene is a centriolar protein involved in primary cilium assembly. Defects in this gene have been associated with infantile nephronophthisis and intellectual disability. [provided by RefSeq, Oct 2016]
SNPs SNP information provided by dbSNP.
11
SNP ID Visualize variation Clinical significance Consequence
rs200971081 T>A Likely-pathogenic Genic downstream transcript variant, non coding transcript variant, coding sequence variant, intron variant, missense variant, downstream transcript variant
rs368619022 G>A,T Pathogenic Non coding transcript variant, genic upstream transcript variant, coding sequence variant, 5 prime UTR variant, missense variant, stop gained
rs369483167 G>A Pathogenic 5 prime UTR variant, stop gained, non coding transcript variant, coding sequence variant
rs587777486 G>A Pathogenic 5 prime UTR variant, coding sequence variant, genic upstream transcript variant, intron variant, non coding transcript variant, stop gained
rs587777487 C>G,T Pathogenic Coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
14
miRTarBase ID miRNA Experiments Reference
MIRT742070 hsa-miR-1306-5p HITS-CLIP 23824327
MIRT742071 hsa-miR-5702 HITS-CLIP 23824327
MIRT742072 hsa-miR-937-5p HITS-CLIP 23824327
MIRT742073 hsa-miR-7641 HITS-CLIP 23824327
MIRT754755 hsa-miR-548c-3p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 23530209, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 23530209
GO:0005813 Component Centrosome IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615847 17966 ENSG00000173588
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y592
Protein name Centrosomal protein of 83 kDa (Cep83) (Coiled-coil domain-containing protein 41) (Renal carcinoma antigen NY-REN-58)
Protein function Component of the distal appendage region of the centriole involved in the initiation of primary cilium assembly. May collaborate with IFT20 in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium during the initiatio
Family and domains
Sequence
MVVSTFTDMDTFPNNFPPGGDSGLTGSQSEFQKMLIDERLRCEHHKANYQTLKAEHTRLQ
NEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRA
QIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKY
ESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKEN
SEAQVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAERLEKELQSSSEQNTFLINKLHK
AEREINTLSSKVKELKHSNKLEITDIKLETARAKSELERERNKIQSELDGLQSDNEILKA
AVEHHKVLLVEKDRELIRKVQAAKEEGYQKLVVLQDEKLELENRLADLEKMKVEHDVWRQ
SEKDQYEEKLRASQMAEEITRKELQSVRLKLQQQIVTIENAEKEKNENSDLKQQISSLQI
QVTSLAQSENDLLNSNQMLKEMVERLKQECRNFRSQAEKAQLEAEKTLEEKQIQWLEEKH
KLHERITDREEKYNQAKEKLQRAAIAQKKRKSLHENKLKRLQEKVEVLEAKKEELETENQ
VLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMEL
PFPPHMQEEQHQRELSLLRKRLEELETTQRKQLEELGSSGE
Sequence length 701
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Ciliopathy Likely pathogenic rs2541287399 RCV003984302
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephronophthisis Pathogenic rs780500128 RCV003483757
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephronophthisis 18 Pathogenic; Likely pathogenic rs922686745, rs1276979881, rs750092874, rs1162641847, rs1555237944, rs2137575733, rs587777486, rs879255575, rs368619022, rs879255576, rs587777487, rs369483167, rs587777488, rs777412559, rs2061111812
View all (17 more)
RCV001383008
RCV001384613
RCV001385312
RCV001866359
RCV001974117
View all (27 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CEP83-related disorder Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CILIOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Chronic kidney disease stage 5 Kidney Disease HPO_DG
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathy Pubtator 33938610 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Congenital neurologic anomalies Drachtman Weinblatt Sitarz syndrome BEFREE 24882706
★☆☆☆☆
Found in Text Mining only
Hydrocephalus Hydrocephalus Pubtator 24882706 Associate
★☆☆☆☆
Found in Text Mining only
Infantile nephronophthisis Nephronophthisis Orphanet
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 24882706
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 24882706 Associate
★☆☆☆☆
Found in Text Mining only
Kidney Diseases Kidney disease Pubtator 33938610, 36222666 Associate
★☆☆☆☆
Found in Text Mining only
Learning Disabilities Learning disorders Pubtator 24882706 Associate
★☆☆☆☆
Found in Text Mining only
Nephritis, Tubulointerstitial Nephritis HPO_DG
★☆☆☆☆
Found in Text Mining only