ANGPTL4 (angiopoietin like 4)

Gene

• Entrez ID: 51129
• Gene name: Angiopoietin like 4
• Gene symbol: ANGPTL4
• Synonyms (NCBI Gene): ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022740	hsa-miR-124-3p	Microarray	18668037
MIRT023828	hsa-miR-1-3p	Microarray	18668037
MIRT438920	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438920	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438920	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438920	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT731623	hsa-miR-134-5p	Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26546816
MIRT731623	hsa-miR-134-5p	Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26546816
MIRT781542	hsa-miR-1304	CLIP-seq
MIRT781543	hsa-miR-134	CLIP-seq
MIRT781544	hsa-miR-3118	CLIP-seq
MIRT781545	hsa-miR-3136-5p	CLIP-seq
MIRT781546	hsa-miR-3164	CLIP-seq
MIRT781547	hsa-miR-4439	CLIP-seq
MIRT781548	hsa-miR-4501	CLIP-seq
MIRT781549	hsa-miR-4513	CLIP-seq
MIRT781550	hsa-miR-4704-3p	CLIP-seq
MIRT781551	hsa-miR-622	CLIP-seq
MIRT781552	hsa-miR-3649	CLIP-seq
MIRT781553	hsa-miR-661	CLIP-seq
MIRT2474072	hsa-miR-1184	CLIP-seq
MIRT2474073	hsa-miR-127-5p	CLIP-seq
MIRT781542	hsa-miR-1304	CLIP-seq
MIRT2474074	hsa-miR-133a	CLIP-seq
MIRT2474075	hsa-miR-133b	CLIP-seq
MIRT2474076	hsa-miR-149	CLIP-seq
MIRT2474077	hsa-miR-3064-5p	CLIP-seq
MIRT2474078	hsa-miR-3545-5p	CLIP-seq
MIRT2474079	hsa-miR-3652	CLIP-seq
MIRT2474080	hsa-miR-3677-3p	CLIP-seq
MIRT2474081	hsa-miR-3921	CLIP-seq
MIRT2474082	hsa-miR-4281	CLIP-seq
MIRT2474083	hsa-miR-4292	CLIP-seq
MIRT2474084	hsa-miR-4303	CLIP-seq
MIRT2474085	hsa-miR-4308	CLIP-seq
MIRT2474086	hsa-miR-4430	CLIP-seq
MIRT2474087	hsa-miR-4435	CLIP-seq
MIRT2474088	hsa-miR-4505	CLIP-seq
MIRT2474089	hsa-miR-4653-5p	CLIP-seq
MIRT2474090	hsa-miR-4682	CLIP-seq
MIRT2474091	hsa-miR-4749-3p	CLIP-seq
MIRT2474092	hsa-miR-4794	CLIP-seq
MIRT2474093	hsa-miR-518d-5p	CLIP-seq
MIRT2474094	hsa-miR-519b-5p	CLIP-seq
MIRT2474095	hsa-miR-519c-5p	CLIP-seq
MIRT2474096	hsa-miR-520c-5p	CLIP-seq
MIRT2474097	hsa-miR-526a	CLIP-seq
MIRT781551	hsa-miR-622	CLIP-seq
MIRT2474098	hsa-miR-642a	CLIP-seq
MIRT2474073	hsa-miR-127-5p	CLIP-seq
MIRT781542	hsa-miR-1304	CLIP-seq
MIRT2474074	hsa-miR-133a	CLIP-seq
MIRT2474075	hsa-miR-133b	CLIP-seq
MIRT2474076	hsa-miR-149	CLIP-seq
MIRT2474077	hsa-miR-3064-5p	CLIP-seq
MIRT2474078	hsa-miR-3545-5p	CLIP-seq
MIRT2474079	hsa-miR-3652	CLIP-seq
MIRT2474081	hsa-miR-3921	CLIP-seq
MIRT2474082	hsa-miR-4281	CLIP-seq
MIRT2474083	hsa-miR-4292	CLIP-seq
MIRT2474085	hsa-miR-4308	CLIP-seq
MIRT2474086	hsa-miR-4430	CLIP-seq
MIRT2474087	hsa-miR-4435	CLIP-seq
MIRT2474088	hsa-miR-4505	CLIP-seq
MIRT2474089	hsa-miR-4653-5p	CLIP-seq
MIRT2474090	hsa-miR-4682	CLIP-seq
MIRT2474091	hsa-miR-4749-3p	CLIP-seq
MIRT2474092	hsa-miR-4794	CLIP-seq
MIRT2474093	hsa-miR-518d-5p	CLIP-seq
MIRT2474094	hsa-miR-519b-5p	CLIP-seq
MIRT2474095	hsa-miR-519c-5p	CLIP-seq
MIRT2474096	hsa-miR-520c-5p	CLIP-seq
MIRT2474097	hsa-miR-526a	CLIP-seq
MIRT781551	hsa-miR-622	CLIP-seq
MIRT2474098	hsa-miR-642a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Activation	12099716;15190076
PPARD	Repression	15190076
PPARG	Activation	15190076
PPARG	Unknown	14570927
SMAD3	Activation	24330518

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	NAS	12707035
GO:0004857	Function	Enzyme inhibitor activity	IBA
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0004857	Function	Enzyme inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	21397862
GO:0005576	Component	Extracellular region	IDA	10698685
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10698685
GO:0005615	Component	Extracellular space	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0010903	Process	Negative regulation of very-low-density lipoprotein particle remodeling	IDA	19542565
GO:0010903	Process	Negative regulation of very-low-density lipoprotein particle remodeling	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0035473	Function	Lipase binding	IPI	19542565
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	19028676
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10698685
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043335	Process	Protein unfolding	IDA	29899144
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	29899144
GO:0045766	Process	Positive regulation of angiogenesis	TAS	11953136
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0055102	Function	Lipase inhibitor activity	IDA	19542565
GO:0070328	Process	Triglyceride homeostasis	IBA
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0070328	Process	Triglyceride homeostasis	ISS
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0090318	Process	Regulation of chylomicron remodeling	IDA	19542565
GO:0090318	Process	Regulation of chylomicron remodeling	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA

Other IDs

• MIM: 605910
• HGNC: 16039
• e!Ensembl: ENSG00000167772

Protein

• UniProt ID: Q9BY76
• Protein name: Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]
• Protein function: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). May also
• PDB: 6EUB, 6U0A, 6U1U, 6U73
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00147	Fibrinogen_C	184 → 400	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood plasma (at protein level) (PubMed:29899519). Detected in liver (PubMed:10698685). Detected in white fat tissue and placenta (PubMed:10866690). Expressed at high levels in the placenta, heart, liver, muscle, pancreas a
• Sequence:

  MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
  RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
  HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
  LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
  WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
  SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
  GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

• Sequence length: 406

Pathways

KEGG:

PPAR signaling pathway
Cholesterol metabolism

Reactome:

PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Assembly of active LPL and LIPC lipase complexes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANGPTL4-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Plasma triglyceride level quantitative trait locus	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20664963, 21308352		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	27282075		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28151839		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	28832635	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	29695708		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	29695708	Inhibit	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29191809, 40008516	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18599063, 18809343, 18940399, 23640487, 25463098, 26944173, 28412693, 28849063, 29563332, 31235370		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15870027		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22866899, 25289668, 34876931	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32410376	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18599063, 18809343, 18940399, 23640487, 25463098, 26944173, 28412693, 28849063, 29563332, 31235370		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18940399	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9973098		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	27519972	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25289668	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	12707035, 26039997	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22921864, 24330518, 26745120, 30518876		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24641868, 34685578	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26745120	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	20660728, 31963541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20454689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	21489049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28230858, 30837223	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34360721	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27166634		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12707035, 20454689, 30272265	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31641008		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	32899312	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	35205232	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18940399, 19851103, 27004807, 29017031, 29548670, 31235370		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27004807, 30779729	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	18940399	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18634015	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	30462206		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29432410		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33750331	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26944173, 28267563, 29432410		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31205547		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28600294		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31205547		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30388624		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35392474	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35732325	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22307217		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21308352, 22307217, 26417691, 28928094, 31264122		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24180698, 32641980, 36553482, 37090726	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	21212665, 26272027, 29221972, 29932521		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31105751		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12707035, 20454689, 21206970, 28110976		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18940399, 20829508, 25463098, 26933753, 26934567, 28412693, 29555209, 29713054, 29899519, 30893111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	27135400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	18940399, 20829508, 25463098, 26871769, 26933753, 26934567, 28412693, 29083408, 29548670, 29555209, 29713054, 30323852, 30326043, 30893111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	26934567, 27135400, 29083408, 29713054, 32440963	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	27135400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	18940399, 26934567, 30326043	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33351885	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18940399, 20829508, 26933753, 26934567, 28412693, 29548670, 29555209, 29713054, 30326043, 30893111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	BEFREE	29100268		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25289668, 30957437		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28287161		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	31130950	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28182091, 28842503, 29899519		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20855567	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26039997	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28182091, 28842503, 29899519, 31387395		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30779729, 34876931	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27004807, 29083408, 29695708, 30275531, 30326043, 33351885, 33909604, 39176085	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27733177, 29490644	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33003532	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18442626, 27733177, 28645936, 29083408, 29490644, 29536615, 29621508, 29695708, 29899519, 30275531, 30326043, 30893111, 31235370, 31772941		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28978304, 31387395, 31772941		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23387337, 33683746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29621508, 31494661		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30049845		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	37781924	Associate	★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	BEFREE	30173855		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	37169211	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	CTD_human_DG	17322881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	18442626, 25463098, 28004425, 28412693, 30893111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	32641980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ectrodactyly	Ectrodactyly	Pubtator	32269565	Associate	★☆☆☆☆ Found in Text Mining only
Enchondromatosis	Enchondromatosis	BEFREE	30173855		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31641008		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	BEFREE	23925665		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37688629	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23925665	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28151839		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	19628874, 29908922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	28842503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	29908922		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15972966		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	20664963		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28903395		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21109939, 25955030, 31717924		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21109939, 25955030, 31717924		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	39776814	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28151839		★☆☆☆☆ Found in Text Mining only
Hallervorden-Spatz Syndrome	Pigmentary pallidal degeneration	BEFREE	12058097		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24114199		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31105751		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	34360721	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	22471940, 29031727		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	22471940	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	19318355		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	33028190	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29490644, 33593372, 35205232	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29490644		★☆☆☆☆ Found in Text Mining only
Hypoprebetalipoproteinemia, Acanthocytosis, Retinitis Pigmentosa, And Pallidal Degeneration	Hypoprebetalipoproteinemia, Acanthocytosis, Retinitis Pigmentosa, And Pallidal Degeneration	BEFREE	12058097		★☆☆☆☆ Found in Text Mining only
Hypotriglyceridemia	Hypotriglyceridemia	BEFREE	16081640		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12707035, 17609976, 18634015, 24180698, 27612459, 29739381, 31963541, 32796743, 36050447, 37264956	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20454689, 22866899, 24114211, 25889814, 26205780, 31862408, 32114885, 34526760, 34853621, 38016947, 39328420	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32816872	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34876931	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	21212665	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	29932521	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26944173, 28267563, 30323852		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	39972951	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	20660728, 21421336		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	28502512		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	26352670, 28441404		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18433990		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25148701, 25908453, 28371666, 30837223		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30621516		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18950674, 36050447	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31963541	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	17130448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20664963, 36793937	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23925665, 35392474, 35732325	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	21974967, 26352670, 28441404		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	23959876		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	23959876		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23617883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22921864, 26745120, 30518876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	12707035		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15377430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27166634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30814490		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28560449, 9973098		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20664963, 28894280, 29436683		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	19775228		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20940405, 21397852, 21397862, 22462789, 22661548, 23208498, 23686315, 25060575, 26417691, 27797381, 28182091, 28641978, 28745316, 29017031, 29035390, 29100268, 29436683, 30518876		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31205547		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22307217		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24330518		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29100268		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33139674, 33196458	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	12707035, 29031727, 29563332		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	12707035	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24626437	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	27004807, 29695708, 31164103, 33593372	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19851103, 23640487, 24626437, 25463098, 27004807, 28182091, 31164103		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34434074	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27519972		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27519972	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30784773, 31130950		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31130950	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26934567	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	31434807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12707035, 19934321, 20454689, 21109939, 21397862, 21841165, 22307217, 23617883, 23686315, 23925665, 25148701, 25999348, 26745120, 26761211, 27282075, 27797381, 28110976, 28894280, 28903395, 29035390, 29100268, 30518876, 31205547, 31264122, 31557193, 31641008, 31741709		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	21151138, 25005737, 27913276, 31772941		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	39776814	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27166634		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17030965, 18728224, 21596930, 21714923, 22462789, 27004807, 28320596, 28733963, 29502266, 29536615, 29727591, 30127377, 30518876, 31207920, 31419758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21596930	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25244256, 27004807, 27733177, 33003532	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	28842503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29695708	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	30254216	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39176085, 39587568	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	21854818		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34876931	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29739381		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29739381	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26205780, 31641008, 34609082	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30814490		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20454689, 27282075, 37291514	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28733963, 31207920, 31598832		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30891777		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	18940399	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	20454689	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29621508		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35140683	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29031854		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28560449, 9973098		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	32280690	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	28873177		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26813452	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	39328420	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12707035		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28110976		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	25005737, 28441404		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30078618		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23959876, 28832635, 29621508		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	28832635	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25289668, 28004425, 28107351, 28458654		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	20660728, 21421336	Associate	★☆☆☆☆ Found in Text Mining only
Schimke immunoosseous dysplasia	Spondyloepiphyseal dysplasia nephrotic syndrome	BEFREE	21327070, 28334870		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22781089		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30524367		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25060575		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23925665		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27797381, 37169211	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27797381, 27865799		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19775228		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19628874, 29908922		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	28842503		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20664963, 28894280, 29436683		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20664963, 32410376, 34708125	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18940399, 32980981	Associate	★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	37689549	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32928141	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28287161		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	21489049		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29035390		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33228592, 35178306	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	26761211		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	20454689		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	21421336	Associate	★☆☆☆☆ Found in Text Mining only