Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51126
Gene name	N-alpha-acetyltransferase 20, NatB catalytic subunit
Gene symbol	NAA20
Synonyms (NCBI Gene)	MRT73NAT3NAT3PNAT5NAT5PdJ1002M8.1
Chromosome	20
Chromosome location	20p11.23
Summary	NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 200

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024560	hsa-miR-215-5p	Microarray	19074876
MIRT026585	hsa-miR-192-5p	Microarray	19074876
MIRT032114	hsa-let-7d-5p	Sequencing	20371350
MIRT052094	hsa-let-7b-5p	CLASH	23622248
MIRT472677	hsa-miR-4500	PAR-CLIP	23592263
MIRT472676	hsa-miR-4458	PAR-CLIP	23592263
MIRT472675	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT472674	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT472673	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT472672	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT032114	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT052094	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT472671	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT472670	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT472669	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT472668	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT201499	hsa-miR-1255a	PAR-CLIP	23592263
MIRT201500	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT472667	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT472677	hsa-miR-4500	PAR-CLIP	23592263
MIRT472676	hsa-miR-4458	PAR-CLIP	23592263
MIRT472675	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT472674	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT472673	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT472672	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT032114	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT052094	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT472671	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT472670	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT472669	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT472668	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT201499	hsa-miR-1255a	PAR-CLIP	23592263
MIRT201500	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT472667	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT1171569	hsa-miR-103a	CLIP-seq
MIRT1171570	hsa-miR-107	CLIP-seq
MIRT1171571	hsa-miR-1237	CLIP-seq
MIRT1171572	hsa-miR-1264	CLIP-seq
MIRT1171573	hsa-miR-1266	CLIP-seq
MIRT1171574	hsa-miR-132	CLIP-seq
MIRT1171575	hsa-miR-140-5p	CLIP-seq
MIRT1171576	hsa-miR-192	CLIP-seq
MIRT1171577	hsa-miR-212	CLIP-seq
MIRT1171578	hsa-miR-215	CLIP-seq
MIRT1171579	hsa-miR-22	CLIP-seq
MIRT1171580	hsa-miR-3150b-3p	CLIP-seq
MIRT1171581	hsa-miR-3664-3p	CLIP-seq
MIRT1171582	hsa-miR-4256	CLIP-seq
MIRT1171583	hsa-miR-4269	CLIP-seq
MIRT1171584	hsa-miR-4282	CLIP-seq
MIRT1171585	hsa-miR-4446-5p	CLIP-seq
MIRT1171586	hsa-miR-4463	CLIP-seq
MIRT1171587	hsa-miR-4514	CLIP-seq
MIRT1171588	hsa-miR-4518	CLIP-seq
MIRT1171589	hsa-miR-4519	CLIP-seq
MIRT1171590	hsa-miR-4689	CLIP-seq
MIRT1171591	hsa-miR-4692	CLIP-seq
MIRT1171592	hsa-miR-4742-5p	CLIP-seq
MIRT1171593	hsa-miR-4755-5p	CLIP-seq
MIRT1171594	hsa-miR-4784	CLIP-seq
MIRT1171595	hsa-miR-548ac	CLIP-seq
MIRT1171596	hsa-miR-548ae	CLIP-seq
MIRT1171597	hsa-miR-548aj	CLIP-seq
MIRT1171598	hsa-miR-548am	CLIP-seq
MIRT1171599	hsa-miR-548d-3p	CLIP-seq
MIRT1171600	hsa-miR-548x	CLIP-seq
MIRT1171601	hsa-miR-548z	CLIP-seq
MIRT1171602	hsa-miR-765	CLIP-seq
MIRT1171572	hsa-miR-1264	CLIP-seq
MIRT1171585	hsa-miR-4446-5p	CLIP-seq
MIRT1171593	hsa-miR-4755-5p	CLIP-seq
MIRT2049503	hsa-miR-518d-5p	CLIP-seq
MIRT2049504	hsa-miR-519b-5p	CLIP-seq
MIRT2049505	hsa-miR-519c-5p	CLIP-seq
MIRT2049506	hsa-miR-520c-5p	CLIP-seq
MIRT2049507	hsa-miR-526a	CLIP-seq
MIRT2278429	hsa-miR-4307	CLIP-seq
MIRT2278430	hsa-miR-567	CLIP-seq
MIRT2454788	hsa-miR-3647-3p	CLIP-seq
MIRT1171571	hsa-miR-1237	CLIP-seq
MIRT2576803	hsa-miR-1248	CLIP-seq
MIRT1171576	hsa-miR-192	CLIP-seq
MIRT1171578	hsa-miR-215	CLIP-seq
MIRT1171579	hsa-miR-22	CLIP-seq
MIRT1171582	hsa-miR-4256	CLIP-seq
MIRT2278429	hsa-miR-4307	CLIP-seq
MIRT2576804	hsa-miR-4452	CLIP-seq
MIRT2576805	hsa-miR-4693-3p	CLIP-seq
MIRT2576806	hsa-miR-4712-3p	CLIP-seq
MIRT2278430	hsa-miR-567	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004596	Function	Protein-N-terminal amino-acid acetyltransferase activity	IBA
GO:0005515	Function	Protein binding	IPI	18570629, 34230638
GO:0005634	Component	Nucleus	IDA	25732826
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	18570629, 25732826
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006474	Process	N-terminal protein amino acid acetylation	IDA	34230638
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0017190	Process	N-terminal peptidyl-aspartic acid acetylation	IDA	34230638
GO:0017192	Process	N-terminal peptidyl-glutamine acetylation	IDA	34230638
GO:0018002	Process	N-terminal peptidyl-glutamic acid acetylation	IDA	34230638
GO:0031416	Component	NatB complex	IBA
GO:0031416	Component	NatB complex	IPI	18570629
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0120518	Function	Protein N-terminal-methionine acetyltransferase activity	IEA

MIM	HGNC	e!Ensembl
610833	15908	ENSG00000173418

P61599

Protein name

N-alpha-acetyltransferase 20 (EC 2.3.1.254) (Methionine N-acetyltransferase) (N-acetyltransferase 5) (N-terminal acetyltransferase B complex catalytic subunit NAA20) (N-terminal acetyltransferase B complex catalytic subunit NAT5) (NatB complex subunit NAT

Protein function

Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln (PubMed:34230638). Proteins with cell cycle functions are overrepresented in

PDB

6VP9 , 7STX , 8G0L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	9 → 128	Acetyltransferase (GNAT) family	Family

Sequence

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK
AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAV
NMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

Sequence length

178

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual developmental disorder, autosomal recessive 73	Likely pathogenic; Pathogenic	rs2146464332, rs768029717	RCV001822970 RCV001822971	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL RECESSIVE NON-SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	33219302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33219302	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NAA20 (N-alpha-acetyltransferase 20, NatB catalytic subunit)