Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5110
Gene name	Protein-L-isoaspartate (D-aspartate) O-methyltransferase
Gene symbol	PCMT1
Synonyms (NCBI Gene)	PIMT
Chromosome	6
Chromosome location	6q25.1
Summary	This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation bac

267

Show/Hide all (267)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031439	hsa-miR-16-5p	Proteomics	18668040
MIRT038565	hsa-miR-106b-3p	CLASH	23622248
MIRT037052	hsa-miR-877-3p	CLASH	23622248
MIRT037052	hsa-miR-877-3p	CLASH	23622248
MIRT555811	hsa-miR-4782-3p	PAR-CLIP	21572407
MIRT555810	hsa-miR-6766-3p	PAR-CLIP	21572407
MIRT555809	hsa-miR-219a-5p	PAR-CLIP	21572407
MIRT098833	hsa-miR-330-3p	PAR-CLIP	21572407
MIRT555808	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT555807	hsa-miR-5688	PAR-CLIP	21572407
MIRT555806	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT555805	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT098841	hsa-miR-548ag	PAR-CLIP	21572407
MIRT098842	hsa-miR-548ai	PAR-CLIP	21572407
MIRT098847	hsa-miR-548ba	PAR-CLIP	21572407
MIRT098838	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT098839	hsa-miR-646	PAR-CLIP	21572407
MIRT555804	hsa-miR-1283	PAR-CLIP	21572407
MIRT098837	hsa-miR-508-3p	PAR-CLIP	21572407
MIRT555803	hsa-miR-4445-5p	PAR-CLIP	21572407
MIRT098840	hsa-miR-3135a	PAR-CLIP	21572407
MIRT098843	hsa-miR-4477b	PAR-CLIP	21572407
MIRT098846	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT098827	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT098829	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031439	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT098830	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT733731	hsa-miR-143-3p	Immunoprecipitaion (IP)In situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blotting	33898446
MIRT555811	hsa-miR-4782-3p	PAR-CLIP	21572407
MIRT555810	hsa-miR-6766-3p	PAR-CLIP	21572407
MIRT555809	hsa-miR-219a-5p	PAR-CLIP	21572407
MIRT098833	hsa-miR-330-3p	PAR-CLIP	21572407
MIRT555808	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT555807	hsa-miR-5688	PAR-CLIP	21572407
MIRT555806	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT555805	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT098841	hsa-miR-548ag	PAR-CLIP	21572407
MIRT098842	hsa-miR-548ai	PAR-CLIP	21572407
MIRT098847	hsa-miR-548ba	PAR-CLIP	21572407
MIRT098838	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT098839	hsa-miR-646	PAR-CLIP	21572407
MIRT555804	hsa-miR-1283	PAR-CLIP	21572407
MIRT098837	hsa-miR-508-3p	PAR-CLIP	21572407
MIRT555803	hsa-miR-4445-5p	PAR-CLIP	21572407
MIRT098840	hsa-miR-3135a	PAR-CLIP	21572407
MIRT098843	hsa-miR-4477b	PAR-CLIP	21572407
MIRT098846	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT1217892	hsa-miR-105	CLIP-seq
MIRT1217893	hsa-miR-1271	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT1217897	hsa-miR-182	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217899	hsa-miR-214	CLIP-seq
MIRT1217900	hsa-miR-217	CLIP-seq
MIRT1217901	hsa-miR-299-5p	CLIP-seq
MIRT1217902	hsa-miR-3185	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217905	hsa-miR-3619-5p	CLIP-seq
MIRT1217906	hsa-miR-3622a-3p	CLIP-seq
MIRT1217907	hsa-miR-3622b-3p	CLIP-seq
MIRT1217908	hsa-miR-3659	CLIP-seq
MIRT1217909	hsa-miR-3913-3p	CLIP-seq
MIRT1217910	hsa-miR-3941	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT1217912	hsa-miR-4291	CLIP-seq
MIRT1217913	hsa-miR-4436a	CLIP-seq
MIRT1217914	hsa-miR-4470	CLIP-seq
MIRT1217915	hsa-miR-4539	CLIP-seq
MIRT1217916	hsa-miR-4658	CLIP-seq
MIRT1217917	hsa-miR-466	CLIP-seq
MIRT1217918	hsa-miR-4672	CLIP-seq
MIRT1217919	hsa-miR-4699-3p	CLIP-seq
MIRT1217920	hsa-miR-4700-3p	CLIP-seq
MIRT1217921	hsa-miR-4709-3p	CLIP-seq
MIRT1217922	hsa-miR-4722-3p	CLIP-seq
MIRT1217923	hsa-miR-4728-3p	CLIP-seq
MIRT1217924	hsa-miR-4769-3p	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT1217926	hsa-miR-499-3p	CLIP-seq
MIRT1217927	hsa-miR-499a-3p	CLIP-seq
MIRT1217928	hsa-miR-5095	CLIP-seq
MIRT1217929	hsa-miR-520d-5p	CLIP-seq
MIRT1217930	hsa-miR-524-5p	CLIP-seq
MIRT1217931	hsa-miR-545	CLIP-seq
MIRT1217932	hsa-miR-548aa	CLIP-seq
MIRT1217933	hsa-miR-574-5p	CLIP-seq
MIRT1217934	hsa-miR-584	CLIP-seq
MIRT1217935	hsa-miR-761	CLIP-seq
MIRT1217936	hsa-miR-889	CLIP-seq
MIRT1217937	hsa-miR-922	CLIP-seq
MIRT1217938	hsa-miR-96	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT2063001	hsa-miR-337-3p	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217909	hsa-miR-3913-3p	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT2063002	hsa-miR-4511	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT2291412	hsa-miR-1197	CLIP-seq
MIRT1217893	hsa-miR-1271	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT1217897	hsa-miR-182	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217899	hsa-miR-214	CLIP-seq
MIRT1217900	hsa-miR-217	CLIP-seq
MIRT2291413	hsa-miR-223	CLIP-seq
MIRT2291414	hsa-miR-224	CLIP-seq
MIRT2291415	hsa-miR-3154	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT2291416	hsa-miR-324-5p	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217905	hsa-miR-3619-5p	CLIP-seq
MIRT2291417	hsa-miR-3667-3p	CLIP-seq
MIRT2291418	hsa-miR-3675-3p	CLIP-seq
MIRT1217910	hsa-miR-3941	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT1217912	hsa-miR-4291	CLIP-seq
MIRT1217914	hsa-miR-4470	CLIP-seq
MIRT2063002	hsa-miR-4511	CLIP-seq
MIRT1217917	hsa-miR-466	CLIP-seq
MIRT1217918	hsa-miR-4672	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT1217931	hsa-miR-545	CLIP-seq
MIRT2291419	hsa-miR-548g	CLIP-seq
MIRT1217935	hsa-miR-761	CLIP-seq
MIRT1217937	hsa-miR-922	CLIP-seq
MIRT2291420	hsa-miR-935	CLIP-seq
MIRT1217938	hsa-miR-96	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217899	hsa-miR-214	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217905	hsa-miR-3619-5p	CLIP-seq
MIRT1217910	hsa-miR-3941	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT1217912	hsa-miR-4291	CLIP-seq
MIRT1217917	hsa-miR-466	CLIP-seq
MIRT1217918	hsa-miR-4672	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT1217931	hsa-miR-545	CLIP-seq
MIRT1217935	hsa-miR-761	CLIP-seq
MIRT1217937	hsa-miR-922	CLIP-seq
MIRT2442451	hsa-miR-1273f	CLIP-seq
MIRT2442452	hsa-miR-143	CLIP-seq
MIRT2442453	hsa-miR-4708-5p	CLIP-seq
MIRT2442454	hsa-miR-4770	CLIP-seq
MIRT2442455	hsa-miR-4775	CLIP-seq
MIRT2442456	hsa-miR-590-3p	CLIP-seq
MIRT1217932	hsa-miR-548aa	CLIP-seq
MIRT2588924	hsa-miR-1257	CLIP-seq
MIRT2442451	hsa-miR-1273f	CLIP-seq
MIRT2588925	hsa-miR-1276	CLIP-seq
MIRT2442452	hsa-miR-143	CLIP-seq
MIRT2588926	hsa-miR-147	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT2588927	hsa-miR-188-5p	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217899	hsa-miR-214	CLIP-seq
MIRT2291414	hsa-miR-224	CLIP-seq
MIRT2588928	hsa-miR-2278	CLIP-seq
MIRT2588929	hsa-miR-298	CLIP-seq
MIRT2588930	hsa-miR-3074-3p	CLIP-seq
MIRT2588931	hsa-miR-3140-3p	CLIP-seq
MIRT2291415	hsa-miR-3154	CLIP-seq
MIRT1217902	hsa-miR-3185	CLIP-seq
MIRT2588932	hsa-miR-3190	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT2588933	hsa-miR-323-5p	CLIP-seq
MIRT2063001	hsa-miR-337-3p	CLIP-seq
MIRT2588934	hsa-miR-3611	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217905	hsa-miR-3619-5p	CLIP-seq
MIRT2291418	hsa-miR-3675-3p	CLIP-seq
MIRT2588935	hsa-miR-3911	CLIP-seq
MIRT1217910	hsa-miR-3941	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT1217912	hsa-miR-4291	CLIP-seq
MIRT2588936	hsa-miR-4468	CLIP-seq
MIRT2063002	hsa-miR-4511	CLIP-seq
MIRT1217917	hsa-miR-466	CLIP-seq
MIRT1217918	hsa-miR-4672	CLIP-seq
MIRT2588937	hsa-miR-4694-5p	CLIP-seq
MIRT2442453	hsa-miR-4708-5p	CLIP-seq
MIRT2588938	hsa-miR-4760-3p	CLIP-seq
MIRT2442454	hsa-miR-4770	CLIP-seq
MIRT2442455	hsa-miR-4775	CLIP-seq
MIRT2588939	hsa-miR-4780	CLIP-seq
MIRT2588940	hsa-miR-4790-3p	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT1217931	hsa-miR-545	CLIP-seq
MIRT1217932	hsa-miR-548aa	CLIP-seq
MIRT2588941	hsa-miR-577	CLIP-seq
MIRT2442456	hsa-miR-590-3p	CLIP-seq
MIRT2588942	hsa-miR-623	CLIP-seq
MIRT2588943	hsa-miR-644	CLIP-seq
MIRT2588944	hsa-miR-7	CLIP-seq
MIRT1217935	hsa-miR-761	CLIP-seq
MIRT2588945	hsa-miR-876-3p	CLIP-seq
MIRT1217936	hsa-miR-889	CLIP-seq
MIRT1217937	hsa-miR-922	CLIP-seq
MIRT2588924	hsa-miR-1257	CLIP-seq
MIRT2442451	hsa-miR-1273f	CLIP-seq
MIRT2588925	hsa-miR-1276	CLIP-seq
MIRT2442452	hsa-miR-143	CLIP-seq
MIRT2588926	hsa-miR-147	CLIP-seq
MIRT1217894	hsa-miR-15a	CLIP-seq
MIRT1217895	hsa-miR-15b	CLIP-seq
MIRT1217896	hsa-miR-16	CLIP-seq
MIRT2588927	hsa-miR-188-5p	CLIP-seq
MIRT1217898	hsa-miR-195	CLIP-seq
MIRT1217899	hsa-miR-214	CLIP-seq
MIRT2291413	hsa-miR-223	CLIP-seq
MIRT2291414	hsa-miR-224	CLIP-seq
MIRT2588928	hsa-miR-2278	CLIP-seq
MIRT2588929	hsa-miR-298	CLIP-seq
MIRT2588931	hsa-miR-3140-3p	CLIP-seq
MIRT2291415	hsa-miR-3154	CLIP-seq
MIRT1217902	hsa-miR-3185	CLIP-seq
MIRT2588932	hsa-miR-3190	CLIP-seq
MIRT1217903	hsa-miR-323-3p	CLIP-seq
MIRT2588933	hsa-miR-323-5p	CLIP-seq
MIRT2063001	hsa-miR-337-3p	CLIP-seq
MIRT2588934	hsa-miR-3611	CLIP-seq
MIRT1217904	hsa-miR-361-5p	CLIP-seq
MIRT1217905	hsa-miR-3619-5p	CLIP-seq
MIRT2291418	hsa-miR-3675-3p	CLIP-seq
MIRT2588935	hsa-miR-3911	CLIP-seq
MIRT1217910	hsa-miR-3941	CLIP-seq
MIRT1217911	hsa-miR-424	CLIP-seq
MIRT1217912	hsa-miR-4291	CLIP-seq
MIRT2588936	hsa-miR-4468	CLIP-seq
MIRT2063002	hsa-miR-4511	CLIP-seq
MIRT1217917	hsa-miR-466	CLIP-seq
MIRT1217918	hsa-miR-4672	CLIP-seq
MIRT2588937	hsa-miR-4694-5p	CLIP-seq
MIRT2442453	hsa-miR-4708-5p	CLIP-seq
MIRT2588938	hsa-miR-4760-3p	CLIP-seq
MIRT2442454	hsa-miR-4770	CLIP-seq
MIRT2442455	hsa-miR-4775	CLIP-seq
MIRT2588939	hsa-miR-4780	CLIP-seq
MIRT2588940	hsa-miR-4790-3p	CLIP-seq
MIRT1217925	hsa-miR-497	CLIP-seq
MIRT1217931	hsa-miR-545	CLIP-seq
MIRT1217932	hsa-miR-548aa	CLIP-seq
MIRT2588941	hsa-miR-577	CLIP-seq
MIRT2442456	hsa-miR-590-3p	CLIP-seq
MIRT2588942	hsa-miR-623	CLIP-seq
MIRT2588943	hsa-miR-644	CLIP-seq
MIRT2588944	hsa-miR-7	CLIP-seq
MIRT1217935	hsa-miR-761	CLIP-seq
MIRT2588945	hsa-miR-876-3p	CLIP-seq
MIRT1217937	hsa-miR-922	CLIP-seq
MIRT2291420	hsa-miR-935	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004719	Function	Protein-L-isoaspartate (D-aspartate) O-methyltransferase activity	IBA
GO:0004719	Function	Protein-L-isoaspartate (D-aspartate) O-methyltransferase activity	IDA	3167043
GO:0004719	Function	Protein-L-isoaspartate (D-aspartate) O-methyltransferase activity	IEA
GO:0004719	Function	Protein-L-isoaspartate (D-aspartate) O-methyltransferase activity	TAS	8074695
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 32838362, 33961781, 34232536
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006479	Process	Protein methylation	IDA	3167043
GO:0006479	Process	Protein methylation	TAS	3355545
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030091	Process	Protein repair	TAS	8074695
GO:0032259	Process	Methylation	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
176851	8728	ENSG00000120265

P22061

Protein name

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PIMT) (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (Protein-beta-aspartate methyltransferase)

Protein function

Initiates the repair of damaged proteins by catalyzing methyl esterification of L-isoaspartyl and D-aspartyl residues produced by spontaneous isomerization and racemization of L-aspartyl and L-asparaginyl residues in aging peptides and proteins

PDB

1I1N , 1KR5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01135	PCMT	8 → 221		Family

Sequence

MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSV
NNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK

Sequence length

227

Interactions

View interactions

	Reactome
			Protein repair

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	21372823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32705859	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	22647835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	37994408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29517839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	22486984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34868337, 35535040, 37953789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25119594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29517839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29772707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29772707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17216280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17216280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17216280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	12390520	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	12390520, 28100787, 29856810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	25465735, 28100787, 29856810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34082401, 35628507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35628507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29772707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37994408	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29517839, 37899170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29517839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29517839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	16256389, 22647835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	16256389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25800307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	18582870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24631677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	18582870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37899170	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rachischisis	Rachischisis	CTD_human_DG	16256389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19110265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	16256389, 22647835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	LHGDN	16256389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	CTD_human_DG	16256389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Dysraphicus	Status Dysraphicus	CTD_human_DG	16256389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28534197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37953789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29517839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase)