YBX2 (Y-box binding protein 2)

Gene

• Entrez ID: 51087
• Gene name: Y-box binding protein 2
• Gene symbol: YBX2
• Synonyms (NCBI Gene): CONTRIN, CSDA3, DBPC, MSY2
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are loc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019164	hsa-miR-335-5p	Microarray	18185580
MIRT1498370	hsa-miR-205	CLIP-seq
MIRT1498371	hsa-miR-2052	CLIP-seq
MIRT1498372	hsa-miR-2392	CLIP-seq
MIRT1498373	hsa-miR-2964a-5p	CLIP-seq
MIRT1498374	hsa-miR-3115	CLIP-seq
MIRT1498375	hsa-miR-3132	CLIP-seq
MIRT1498376	hsa-miR-3153	CLIP-seq
MIRT1498377	hsa-miR-3161	CLIP-seq
MIRT1498378	hsa-miR-3667-3p	CLIP-seq
MIRT1498379	hsa-miR-3936	CLIP-seq
MIRT1498380	hsa-miR-4287	CLIP-seq
MIRT1498381	hsa-miR-4668-5p	CLIP-seq
MIRT1498382	hsa-miR-4685-3p	CLIP-seq
MIRT1498383	hsa-miR-4694-5p	CLIP-seq
MIRT1498384	hsa-miR-4716-3p	CLIP-seq
MIRT1498385	hsa-miR-4723-5p	CLIP-seq
MIRT1498386	hsa-miR-4728-5p	CLIP-seq
MIRT1498387	hsa-miR-4780	CLIP-seq
MIRT1498388	hsa-miR-552	CLIP-seq
MIRT1498389	hsa-miR-939	CLIP-seq
MIRT1498381	hsa-miR-4668-5p	CLIP-seq
MIRT1498384	hsa-miR-4716-3p	CLIP-seq
MIRT2150101	hsa-miR-570	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10100484
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10100484
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10100484
GO:0007283	Process	Spermatogenesis	TAS	10100484
GO:0009386	Process	Translational attenuation	TAS	10100484
GO:0010468	Process	Regulation of gene expression	IBA
GO:0048599	Process	Oocyte development	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28970281

Other IDs

• MIM: 611447
• HGNC: 17948
• e!Ensembl: ENSG00000006047

Protein

• UniProt ID: Q9Y2T7
• Protein name: Y-box-binding protein 2 (Contrin) (DNA-binding protein C) (Dbpc) (Germ cell-specific Y-box-binding protein) (MSY2 homolog)
• Protein function: Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a s
• PDB: 7F3I, 7F3J, 7F3K, 7F3L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00313	CSD	94 → 163		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in oocytes and testicular germ cells in the stage of spermatogonia to spermatocyte. Also observed placental trophoblasts, as well as in vascular smooth muscle cells in the pulmonary artery, myocardium, and skeletal muscle. Un
• Sequence:

  MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSA
  PGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVF
  VHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKS
  RRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRP
  PNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDG
  ETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTT
  TILE

• Sequence length: 364

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Azoospermia	Azoospermia	BEFREE	18339382, 26804374		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28263985	Associate	★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	LHGDN	16479255		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33602962	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33638948	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	18339382	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16479255	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	16479255		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	16479255	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31161900, 35156507	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33589575	Associate	★☆☆☆☆ Found in Text Mining only