Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51085
Gene name	MLX interacting protein like
Gene symbol	MLXIPL
Synonyms (NCBI Gene)	CHREBPMIOMLXMONDOBWBSCR14WS-bHLHbHLHd14
Chromosome	7
Chromosome location	7q11.23
Summary	This gene encodes a basic helix-loop-helix leucine zipper transcription factor of the Myc/Max/Mad superfamily. This protein forms a heterodimeric complex and binds and activates, in a glucose-dependent manner, carbohydrate response element (ChoRE) motifs

301

Show/Hide all (301)

miRTarBase ID	miRNA	Experiments	Reference
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT629338	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT629338	hsa-miR-18a-3p	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT615322	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT615321	hsa-miR-5193	HITS-CLIP	23824327
MIRT615320	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT615319	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT615318	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT615317	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT615316	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT615315	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT609730	hsa-miR-8485	HITS-CLIP	23824327
MIRT609729	hsa-miR-4643	HITS-CLIP	23824327
MIRT609728	hsa-miR-1322	HITS-CLIP	23824327
MIRT609727	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT609726	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT1152666	hsa-miR-3202	CLIP-seq
MIRT1152667	hsa-miR-3692	CLIP-seq
MIRT1152668	hsa-miR-371b-3p	CLIP-seq
MIRT1152669	hsa-miR-4476	CLIP-seq
MIRT1152670	hsa-miR-4756-3p	CLIP-seq
MIRT1152671	hsa-miR-486-3p	CLIP-seq
MIRT2273054	hsa-miR-1915	CLIP-seq
MIRT2273055	hsa-miR-361-3p	CLIP-seq
MIRT2273056	hsa-miR-3922-5p	CLIP-seq
MIRT2273057	hsa-miR-4436b-3p	CLIP-seq
MIRT2273058	hsa-miR-4685-5p	CLIP-seq
MIRT2273059	hsa-miR-4686	CLIP-seq
MIRT2273060	hsa-miR-4765	CLIP-seq
MIRT2438597	hsa-miR-1291	CLIP-seq
MIRT2438598	hsa-miR-1343	CLIP-seq
MIRT2438599	hsa-miR-1976	CLIP-seq
MIRT2438600	hsa-miR-3176	CLIP-seq
MIRT2438601	hsa-miR-328	CLIP-seq
MIRT2438602	hsa-miR-3922-3p	CLIP-seq
MIRT2438603	hsa-miR-4639-3p	CLIP-seq
MIRT2438604	hsa-miR-668	CLIP-seq
MIRT2273054	hsa-miR-1915	CLIP-seq
MIRT2273055	hsa-miR-361-3p	CLIP-seq
MIRT2454218	hsa-miR-3690	CLIP-seq
MIRT2454219	hsa-miR-4725-5p	CLIP-seq
MIRT2454220	hsa-miR-504	CLIP-seq
MIRT2454221	hsa-miR-711	CLIP-seq
MIRT2438597	hsa-miR-1291	CLIP-seq
MIRT2438598	hsa-miR-1343	CLIP-seq
MIRT2438599	hsa-miR-1976	CLIP-seq
MIRT2438600	hsa-miR-3176	CLIP-seq
MIRT2438601	hsa-miR-328	CLIP-seq
MIRT2438602	hsa-miR-3922-3p	CLIP-seq
MIRT2438603	hsa-miR-4639-3p	CLIP-seq
MIRT2438604	hsa-miR-668	CLIP-seq

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000785	Component	Chromatin	IDA	21084751
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	21084751
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS	11230181
GO:0003677	Function	DNA binding	NAS	10780788
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10780788
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	11230181
GO:0005634	Component	Nucleus	NAS	10780788
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	NAS	11230181
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	11230181
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	10780788
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19995986
GO:0008610	Process	Lipid biosynthetic process	IDA	21084751
GO:0008610	Process	Lipid biosynthetic process	IDA	21084751
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9860302
GO:0010255	Process	Glucose mediated signaling pathway	IEA
GO:0010255	Process	Glucose mediated signaling pathway	ISS
GO:0035538	Function	Carbohydrate response element binding	TAS	18591247
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS	11230181
GO:0042803	Function	Protein homodimerization activity	IDA	11230181
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	ISS	11230181
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045821	Process	Positive regulation of glycolytic process	IMP	19995986
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS	11230181
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS	11230181
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	11230181
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	19995986
GO:0046982	Function	Protein heterodimerization activity	IPI	11230181
GO:0046983	Function	Protein dimerization activity	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	11230181
GO:0070328	Process	Triglyceride homeostasis	NAS	19571538
GO:0090324	Process	Negative regulation of oxidative phosphorylation	IMP	19995986
GO:0097009	Process	Energy homeostasis	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IDA	21084751
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IMP	19995986

MIM	HGNC	e!Ensembl
605678	12744	ENSG00000009950

Q9NP71

Protein name

Carbohydrate-responsive element-binding protein (ChREBP) (Class D basic helix-loop-helix protein 14) (bHLHd14) (MLX interactor) (MLX-interacting protein-like) (WS basic-helix-loop-helix leucine zipper protein) (WS-bHLH) (Williams-Beuren syndrome chromosom

Protein function

Binds DNA as a heterodimer with MLX/TCFL4 and activates transcription. Binds to the canonical E box sequence 5'-CACGTG-3'. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation (By

PDB

6MJL , 6YGJ , 8BTQ , 8BWE , 8BWH , 8C1Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	650 → 704	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver, heart, kidney, cerebellum and intestinal tissues.

Sequence

MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSD
SLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGR
QLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS
DFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARN
SCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAP
PTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYS
EPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQA
LEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAER
LSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRITHISAEQK
RRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAGLQEEAQQLRDE
IEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFE
SFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQAT
RAVTEGTLGKPL

Sequence length

852

Interactions

View interactions

	KEGG		Reactome
	Insulin resistance Non-alcoholic fatty liver disease		PKA-mediated phosphorylation of key metabolic factors ChREBP activates metabolic gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MLXIPL-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Williams syndrome	Benign; Likely benign	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
WILLIAMS-BEUREN SYNDROME	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (137)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33083483, 37074818	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	33083483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30354298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	30354298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26411684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26411684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31413120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23830516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Diverticulum	Bladder Diverticulum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	21092186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19252981, 24366300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24366300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28816938, 31407220, 33656238, 36809979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27854512		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31782782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31782782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32144313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24055811, 31409643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32144313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19571538, 21726544, 25179879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	19571538, 21726544, 25179879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	25179879	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	23840567, 29848931, 37074818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19571538, 21726544, 23840567, 25179879, 29848931		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	25179879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	25179879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18596051, 22466288, 31505737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18596051, 22466288, 31505737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	32144313, 35908073	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19680233, 30956117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23209190	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19680233, 22749234, 23209190, 30029691, 30047462, 30420491, 31623194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24616092, 28121358, 30420491, 31813922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	22840581, 34270325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29858861, 31309533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21084751, 21471514, 22546860, 23022226, 26526060, 27919710, 27992582, 28855500, 29107286, 29534306, 30405056, 31227231, 31809000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25406988, 29786745	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31227231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28123933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Food intolerance (disorder)	Food Intolerance	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	30158026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	24616092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type I	Glycogen Storage Disease	BEFREE	20854262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	29976226	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	17379603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary fructose intolerance syndrome	Hereditary fructosuria	BEFREE	30158026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20551925, 23022226, 23209190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30381838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30405056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	25176936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	24448738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30707786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21192937	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24366300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23830516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19680233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30158026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20158509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19878707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	27224916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27224916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19052253, 28027934, 29965794, 31407220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21147110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	29534502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19252981, 24366300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28816938, 31407220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27919710, 31407220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31782782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24366300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27919710, 29098321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32144313, 36432414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	38201907	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21079391, 28855500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	26411684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24448738	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	26725848, 27224916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26177557, 28027934, 28123933, 29786745, 30047462, 30719457, 30802722, 31004931		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	18596051, 26526060, 28241431, 29531563		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21840420, 32144313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic kidney	Pelvic kidney	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral pulmonary artery stenosis	Peripheral pulmonary artery stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19052253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24845031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24664750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17379603, 21084751, 21471514, 22546860, 23022226, 26526060, 27919710, 27992582, 28628040, 28855500, 29107286, 29534306, 29786745, 30029691, 30405056, 31227231, 31809000 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Supravalvular aortic stenosis	Supravalvar aortic stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	ORPHANET_DG	23830507, 23830516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu arteritis	Takayasu Arteritis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	24548718, 26996483, 27769046, 30354298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	10780788, 11230181, 15163635		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Williams Syndrome	Williams syndrome	Pubtator	31413120	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Williams Syndrome	Williams Syndrome	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

MLXIPL (MLX interacting protein like)