Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51083
Gene name	Galanin and GMAP prepropeptide
Gene symbol	GAL
Synonyms (NCBI Gene)	ETL8GAL-GMAPGALNGLNNGMAP
Chromosome	11
Chromosome location	11q13.2
Summary	This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT551980	hsa-miR-7151-5p	PAR-CLIP	21572407
MIRT060523	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT551979	hsa-miR-885-5p	PAR-CLIP	21572407
MIRT060526	hsa-miR-4671-5p	PAR-CLIP	21572407
MIRT060522	hsa-miR-345-5p	PAR-CLIP	21572407
MIRT551978	hsa-miR-20a-3p	PAR-CLIP	21572407
MIRT060527	hsa-miR-4699-5p	PAR-CLIP	21572407
MIRT060525	hsa-miR-4522	PAR-CLIP	21572407
MIRT551980	hsa-miR-7151-5p	PAR-CLIP	21572407
MIRT060523	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT551979	hsa-miR-885-5p	PAR-CLIP	21572407
MIRT060526	hsa-miR-4671-5p	PAR-CLIP	21572407
MIRT060522	hsa-miR-345-5p	PAR-CLIP	21572407
MIRT551978	hsa-miR-20a-3p	PAR-CLIP	21572407
MIRT060527	hsa-miR-4699-5p	PAR-CLIP	21572407
MIRT060525	hsa-miR-4522	PAR-CLIP	21572407
MIRT1010394	hsa-miR-3120-3p	CLIP-seq
MIRT1010395	hsa-miR-617	CLIP-seq
MIRT1999233	hsa-miR-3922-5p	CLIP-seq
MIRT1010394	hsa-miR-3120-3p	CLIP-seq
MIRT1010395	hsa-miR-617	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004966	Function	Galanin receptor activity	IMP	25691535
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	24517231
GO:0005184	Function	Neuropeptide hormone activity	NAS	1722333
GO:0005515	Function	Protein binding	IPI	23597562, 25416956, 25691535, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9402244
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007631	Process	Feeding behavior	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010737	Process	Protein kinase A signaling	IDA	17982695
GO:0030073	Process	Insulin secretion	NAS	1370155
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0031763	Function	Galanin receptor binding	IBA
GO:0031764	Function	Type 1 galanin receptor binding	IDA	24517231
GO:0031765	Function	Type 2 galanin receptor binding	IDA	24517231
GO:0031766	Function	Type 3 galanin receptor binding	IDA	24517231
GO:0031943	Process	Regulation of glucocorticoid metabolic process	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0043025	Component	Neuronal cell body	IDA	23415787
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0051464	Process	Positive regulation of cortisol secretion	IDA	17982695
GO:0051795	Process	Positive regulation of timing of catagen	IDA	22329353
GO:0060746	Process	Parental behavior	IEA
GO:1902608	Process	Positive regulation of large conductance calcium-activated potassium channel activity	IDA	24602615

MIM	HGNC	e!Ensembl
137035	4114	ENSG00000069482

P22466

Protein name

Galanin peptides [Cleaved into: Galanin; Galanin message-associated peptide (GMAP)]

Protein function

Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth

PDB

7S3O , 7S3Q , 7S3R , 7WQ3 , 7WQ4 , 7XBD , 7XJJ , 7XJK , 8DHZ , 8DJ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01296	Galanin	33 → 61	Galanin	Family
PF06540	GMAP	62 → 122	Galanin message associated peptide (GMAP)	Family

Sequence

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGL
TSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI
ERS

Sequence length

123

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial temporal lobe epilepsy 8	Pathogenic	rs1057517661	RCV000412584	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL DOMINANT LATERAL TEMPORAL LOBE EPILEPSY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, FAMILIAL TEMPORAL LOBE, 8	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAL-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

GAL (galanin and GMAP prepropeptide)