THAP4 (THAP domain containing 4)

Gene

• Entrez ID: 51078
• Gene name: THAP domain containing 4
• Gene symbol: THAP4
• Synonyms (NCBI Gene): CGI-36, Nb(III), PP238
• Chromosome: 2
• Chromosome location: 2q37.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052810	hsa-miR-3187-3p	CLASH	23622248
MIRT1422481	hsa-miR-3157-5p	CLIP-seq
MIRT1422482	hsa-miR-4272	CLIP-seq
MIRT1422483	hsa-miR-4668-3p	CLIP-seq
MIRT1422484	hsa-miR-4691-3p	CLIP-seq
MIRT1422485	hsa-miR-4698	CLIP-seq
MIRT1422486	hsa-miR-548c-3p	CLIP-seq
MIRT1422487	hsa-miR-378	CLIP-seq
MIRT1422488	hsa-miR-378b	CLIP-seq
MIRT1422489	hsa-miR-378c	CLIP-seq
MIRT1422490	hsa-miR-378d	CLIP-seq
MIRT1422491	hsa-miR-378e	CLIP-seq
MIRT1422492	hsa-miR-378f	CLIP-seq
MIRT1422493	hsa-miR-378h	CLIP-seq
MIRT1422494	hsa-miR-378i	CLIP-seq
MIRT1422495	hsa-miR-422a	CLIP-seq
MIRT1422496	hsa-miR-4638-3p	CLIP-seq
MIRT1422497	hsa-miR-4712-5p	CLIP-seq
MIRT1422498	hsa-miR-494	CLIP-seq
MIRT1422499	hsa-miR-659	CLIP-seq
MIRT1422500	hsa-miR-770-5p	CLIP-seq
MIRT2126775	hsa-miR-1245b-5p	CLIP-seq
MIRT2126776	hsa-miR-3120-5p	CLIP-seq
MIRT2126777	hsa-miR-3142	CLIP-seq
MIRT2126778	hsa-miR-3199	CLIP-seq
MIRT2126779	hsa-miR-4727-5p	CLIP-seq
MIRT1422499	hsa-miR-659	CLIP-seq
MIRT1422497	hsa-miR-4712-5p	CLIP-seq
MIRT1422500	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006570	Process	Tyrosine metabolic process	IDA	30524950
GO:0008270	Function	Zinc ion binding	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0020037	Function	Heme binding	IMP	21387410
GO:0042126	Process	Nitrate metabolic process	IDA	30524950
GO:0042802	Function	Identical protein binding	IPI	21387410, 32296183
GO:0046872	Function	Metal ion binding	IEA
GO:0062213	Function	Peroxynitrite isomerase activity	IDA	30524950
GO:0062213	Function	Peroxynitrite isomerase activity	IEA
GO:0070026	Function	Nitric oxide binding	IDA	30524950

Other IDs

• MIM: 612533
• HGNC: 23187
• e!Ensembl: ENSG00000176946

Protein

• UniProt ID: Q8WY91
• Protein name: Peroxynitrite isomerase THAP4 (EC 5.99.-.-) (Ferric Homo sapiens nitrobindin) (Hs-Nb(III)) (THAP domain-containing protein 4)
• Protein function: Heme-binding protein able to scavenge peroxynitrite and to protect free L-tyrosine against peroxynitrite-mediated nitration, by acting as a peroxynitrite isomerase that converts peroxynitrite to nitrate. Therefore, this protein likely plays a ro
• PDB: 3IA8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05485	THAP	5 → 85	THAP domain	Domain
  PF08768	DUF1794	421 → 574	Domain of unknown function (DUF1794)	Domain

• Sequence:

  MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHF
  TKDSFSKRLEDQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAAT
  SRGAAGWSPSSSGNPMAKPESRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLA
  TMVAGSQGKAEASATDAGDESATSSIEGGVTDKSGISMDDFTPPGSGACKFIGSLHSYSF
  SSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGLAQSPPSSSLTATPQKPSQSP
  SAPPADVTPKPATEAVQSEHSDASPMSINEVILSASGACKLIDSLHSYCFSSRQNKSQVC
  CLREQVEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVPYPSSLLSPSREPPKMNP
  VVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMH
  RECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQIT
  RKFRLNSEGKLEQTVSMATTTQPMTQHLHVTYKKVTP

• Sequence length: 577

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations