Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51072
Gene name	Mediator of cell motility 1
Gene symbol	MEMO1
Synonyms (NCBI Gene)	C2orf4CGI-27MEMONS5ATP7
Chromosome	2
Chromosome location	2p22.3

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT648563	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT648562	hsa-miR-4477a	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615881	hsa-miR-3609	HITS-CLIP	23824327
MIRT615880	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT473356	hsa-miR-324-5p	PAR-CLIP	23592263
MIRT473353	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT473350	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT473349	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT473348	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT473347	hsa-miR-3687	PAR-CLIP	23592263
MIRT473346	hsa-miR-4442	PAR-CLIP	23592263
MIRT473344	hsa-miR-3665	PAR-CLIP	23592263
MIRT473343	hsa-miR-657	PAR-CLIP	23592263
MIRT473339	hsa-miR-3944-5p	PAR-CLIP	23592263
MIRT473338	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT473337	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT473335	hsa-miR-4642	PAR-CLIP	23592263
MIRT473356	hsa-miR-324-5p	PAR-CLIP	23592263
MIRT473353	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT473354	hsa-miR-3929	PAR-CLIP	23592263
MIRT473352	hsa-miR-4419b	PAR-CLIP	23592263
MIRT473351	hsa-miR-4478	PAR-CLIP	23592263
MIRT473350	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT473349	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT473348	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT473347	hsa-miR-3687	PAR-CLIP	23592263
MIRT473346	hsa-miR-4442	PAR-CLIP	23592263
MIRT473345	hsa-miR-645	PAR-CLIP	23592263
MIRT473344	hsa-miR-3665	PAR-CLIP	23592263
MIRT473343	hsa-miR-657	PAR-CLIP	23592263
MIRT473342	hsa-miR-4505	PAR-CLIP	23592263
MIRT473341	hsa-miR-5787	PAR-CLIP	23592263
MIRT473340	hsa-miR-3649	PAR-CLIP	23592263
MIRT473339	hsa-miR-3944-5p	PAR-CLIP	23592263
MIRT473338	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT473337	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT473335	hsa-miR-4642	PAR-CLIP	23592263
MIRT648563	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT648562	hsa-miR-4477a	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615881	hsa-miR-3609	HITS-CLIP	23824327
MIRT615880	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT615879	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT473356	hsa-miR-324-5p	PAR-CLIP	23592263
MIRT473353	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT473350	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT473349	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT473348	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT473347	hsa-miR-3687	PAR-CLIP	23592263
MIRT473346	hsa-miR-4442	PAR-CLIP	23592263
MIRT473344	hsa-miR-3665	PAR-CLIP	23592263
MIRT473343	hsa-miR-657	PAR-CLIP	23592263
MIRT473339	hsa-miR-3944-5p	PAR-CLIP	23592263
MIRT473338	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT473337	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT473335	hsa-miR-4642	PAR-CLIP	23592263
MIRT473356	hsa-miR-324-5p	PAR-CLIP	23592263
MIRT473353	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT473354	hsa-miR-3929	PAR-CLIP	23592263
MIRT473352	hsa-miR-4419b	PAR-CLIP	23592263
MIRT473351	hsa-miR-4478	PAR-CLIP	23592263
MIRT473350	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT473349	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT473348	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT473347	hsa-miR-3687	PAR-CLIP	23592263
MIRT473346	hsa-miR-4442	PAR-CLIP	23592263
MIRT473345	hsa-miR-645	PAR-CLIP	23592263
MIRT473344	hsa-miR-3665	PAR-CLIP	23592263
MIRT473343	hsa-miR-657	PAR-CLIP	23592263
MIRT473342	hsa-miR-4505	PAR-CLIP	23592263
MIRT473341	hsa-miR-5787	PAR-CLIP	23592263
MIRT473340	hsa-miR-3649	PAR-CLIP	23592263
MIRT473339	hsa-miR-3944-5p	PAR-CLIP	23592263
MIRT473338	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT473337	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT473335	hsa-miR-4642	PAR-CLIP	23592263
MIRT1142871	hsa-miR-130a	CLIP-seq
MIRT1142872	hsa-miR-130b	CLIP-seq
MIRT1142873	hsa-miR-19a	CLIP-seq
MIRT1142874	hsa-miR-19b	CLIP-seq
MIRT1142875	hsa-miR-2276	CLIP-seq
MIRT1142876	hsa-miR-301a	CLIP-seq
MIRT1142877	hsa-miR-301b	CLIP-seq
MIRT1142878	hsa-miR-3201	CLIP-seq
MIRT1142879	hsa-miR-3666	CLIP-seq
MIRT1142880	hsa-miR-3669	CLIP-seq
MIRT1142881	hsa-miR-4295	CLIP-seq
MIRT1142882	hsa-miR-454	CLIP-seq
MIRT1142883	hsa-miR-455-5p	CLIP-seq
MIRT1142884	hsa-miR-4766-5p	CLIP-seq
MIRT1142885	hsa-miR-4772-3p	CLIP-seq
MIRT1142886	hsa-miR-4778-5p	CLIP-seq
MIRT1142887	hsa-miR-4791	CLIP-seq
MIRT1142888	hsa-miR-518a-5p	CLIP-seq
MIRT1142889	hsa-miR-527	CLIP-seq
MIRT1142890	hsa-miR-651	CLIP-seq
MIRT1142891	hsa-miR-1267	CLIP-seq
MIRT1142892	hsa-miR-129-3p	CLIP-seq
MIRT1142871	hsa-miR-130a	CLIP-seq
MIRT1142872	hsa-miR-130b	CLIP-seq
MIRT1142893	hsa-miR-1323	CLIP-seq
MIRT1142873	hsa-miR-19a	CLIP-seq
MIRT1142874	hsa-miR-19b	CLIP-seq
MIRT1142875	hsa-miR-2276	CLIP-seq
MIRT1142876	hsa-miR-301a	CLIP-seq
MIRT1142877	hsa-miR-301b	CLIP-seq
MIRT1142894	hsa-miR-3121-3p	CLIP-seq
MIRT1142895	hsa-miR-3154	CLIP-seq
MIRT1142896	hsa-miR-3613-3p	CLIP-seq
MIRT1142897	hsa-miR-3613-5p	CLIP-seq
MIRT1142879	hsa-miR-3666	CLIP-seq
MIRT1142880	hsa-miR-3669	CLIP-seq
MIRT1142881	hsa-miR-4295	CLIP-seq
MIRT1142898	hsa-miR-450b-5p	CLIP-seq
MIRT1142882	hsa-miR-454	CLIP-seq
MIRT1142883	hsa-miR-455-5p	CLIP-seq
MIRT1142899	hsa-miR-4687-5p	CLIP-seq
MIRT1142900	hsa-miR-4766-3p	CLIP-seq
MIRT1142884	hsa-miR-4766-5p	CLIP-seq
MIRT1142885	hsa-miR-4772-3p	CLIP-seq
MIRT1142886	hsa-miR-4778-5p	CLIP-seq
MIRT1142888	hsa-miR-518a-5p	CLIP-seq
MIRT1142889	hsa-miR-527	CLIP-seq
MIRT1142901	hsa-miR-548a-3p	CLIP-seq
MIRT1142902	hsa-miR-548ae	CLIP-seq
MIRT1142903	hsa-miR-548aj	CLIP-seq
MIRT1142904	hsa-miR-548am	CLIP-seq
MIRT1142905	hsa-miR-548e	CLIP-seq
MIRT1142906	hsa-miR-548f	CLIP-seq
MIRT1142907	hsa-miR-548g	CLIP-seq
MIRT1142908	hsa-miR-548o	CLIP-seq
MIRT1142909	hsa-miR-548x	CLIP-seq
MIRT1142910	hsa-miR-607	CLIP-seq
MIRT2040674	hsa-miR-3667-3p	CLIP-seq
MIRT1142880	hsa-miR-3669	CLIP-seq
MIRT1142883	hsa-miR-455-5p	CLIP-seq
MIRT1142884	hsa-miR-4766-5p	CLIP-seq
MIRT1142891	hsa-miR-1267	CLIP-seq
MIRT2270387	hsa-miR-203	CLIP-seq
MIRT2270388	hsa-miR-219-1-3p	CLIP-seq
MIRT1142894	hsa-miR-3121-3p	CLIP-seq
MIRT2270389	hsa-miR-3132	CLIP-seq
MIRT1142895	hsa-miR-3154	CLIP-seq
MIRT1142897	hsa-miR-3613-5p	CLIP-seq
MIRT1142900	hsa-miR-4766-3p	CLIP-seq
MIRT2270390	hsa-miR-571	CLIP-seq
MIRT2270391	hsa-miR-582-3p	CLIP-seq
MIRT2040674	hsa-miR-3667-3p	CLIP-seq
MIRT2569579	hsa-miR-1202	CLIP-seq
MIRT2569580	hsa-miR-142-5p	CLIP-seq
MIRT2270387	hsa-miR-203	CLIP-seq
MIRT2270388	hsa-miR-219-1-3p	CLIP-seq
MIRT2569581	hsa-miR-3064-3p	CLIP-seq
MIRT2569582	hsa-miR-3157-3p	CLIP-seq
MIRT2569583	hsa-miR-3194-5p	CLIP-seq
MIRT2569584	hsa-miR-340	CLIP-seq
MIRT2569585	hsa-miR-3614-3p	CLIP-seq
MIRT2040674	hsa-miR-3667-3p	CLIP-seq
MIRT2569586	hsa-miR-3972	CLIP-seq
MIRT2569587	hsa-miR-4297	CLIP-seq
MIRT2569588	hsa-miR-4422	CLIP-seq
MIRT2569589	hsa-miR-4436b-5p	CLIP-seq
MIRT2569590	hsa-miR-4698	CLIP-seq
MIRT2270390	hsa-miR-571	CLIP-seq
MIRT2569579	hsa-miR-1202	CLIP-seq
MIRT2569580	hsa-miR-142-5p	CLIP-seq
MIRT2270387	hsa-miR-203	CLIP-seq
MIRT2270388	hsa-miR-219-1-3p	CLIP-seq
MIRT2569581	hsa-miR-3064-3p	CLIP-seq
MIRT2569582	hsa-miR-3157-3p	CLIP-seq
MIRT2569583	hsa-miR-3194-5p	CLIP-seq
MIRT2569584	hsa-miR-340	CLIP-seq
MIRT2569585	hsa-miR-3614-3p	CLIP-seq
MIRT2040674	hsa-miR-3667-3p	CLIP-seq
MIRT2569586	hsa-miR-3972	CLIP-seq
MIRT2569587	hsa-miR-4297	CLIP-seq
MIRT2569588	hsa-miR-4422	CLIP-seq
MIRT2569589	hsa-miR-4436b-5p	CLIP-seq
MIRT2684835	hsa-miR-4476	CLIP-seq
MIRT2684836	hsa-miR-4477b	CLIP-seq
MIRT2684837	hsa-miR-4533	CLIP-seq
MIRT2569590	hsa-miR-4698	CLIP-seq
MIRT2684838	hsa-miR-4759	CLIP-seq
MIRT2270390	hsa-miR-571	CLIP-seq
MIRT2040674	hsa-miR-3667-3p	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21516116, 21840311, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005829	Component	Cytosol	HDA	16780588
GO:0005829	Component	Cytosol	TAS
GO:0032886	Process	Regulation of microtubule-based process	IMP	20937854

MIM	HGNC	e!Ensembl
611786	14014	ENSG00000162959

Q9Y316

Protein name

Protein MEMO1 (C21orf19-like protein) (Hepatitis C virus NS5A-transactivated protein 7) (HCV NS5A-transactivated protein 7) (Mediator of ErbB2-driven cell motility 1) (Mediator of cell motility 1) (Memo-1)

Protein function

May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubul

PDB

3BCZ , 3BD0 , 7KQ8 , 7L5C , 7M8H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01875	Memo	9 → 293	Memo-like protein	Family

Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAA
HAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFE
RMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADP
SNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH
NTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

Sequence length

297

Interactions

View interactions

	Reactome
			ERBB2 Regulates Cell Motility

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	29146897		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	23770814, 27941874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37487298, 38640016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21375733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	17600233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27941874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33218285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28040480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23770814, 27941874		★★★★★ ★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	27506760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29313875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21375733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8895520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21375733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	12445306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35581960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36197110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MEMO1 (mediator of cell motility 1)