Gene Gene information from NCBI Gene database.
Entrez ID 51062
Gene name Atlastin GTPase 1
Gene symbol ATL1
Synonyms (NCBI Gene)
AD-FSPATL-1FSP1GBP3HSN1DSPG3SPG3Aatlastin1
Chromosome 14
Chromosome location 14q22.1
Summary The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may
SNPs SNP information provided by dbSNP.
42
SNP ID Visualize variation Clinical significance Consequence
rs28939094 A>G,T Uncertain-significance, likely-pathogenic Coding sequence variant, missense variant
rs119476046 C>T Pathogenic, pathogenic-likely-pathogenic Missense variant, coding sequence variant
rs119476047 C>A Pathogenic Missense variant, coding sequence variant
rs119476048 A>G Pathogenic Missense variant, coding sequence variant
rs119476049 G>A Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
16
miRTarBase ID miRNA Experiments Reference
MIRT018361 hsa-miR-335-5p Microarray 18185580
MIRT021430 hsa-miR-9-5p Microarray 17612493
MIRT051409 hsa-let-7f-5p CLASH 23622248
MIRT805782 hsa-miR-1272 CLIP-seq
MIRT805783 hsa-miR-1322 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0005515 Function Protein binding IPI 16815977, 19665976, 20200447, 23969831, 25751282, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606439 11231 ENSG00000198513
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXF7
Protein name Atlastin-1 (ATL-1) (EC 3.6.5.-) (Brain-specific GTP-binding protein) (GTP-binding protein 3) (GBP-3) (hGBP3) (Guanine nucleotide-binding protein 3) (Spastic paraplegia 3 protein A)
Protein function Atlastin-1 (ATL1) is a membrane-anchored GTPase that mediates the GTP-dependent fusion of endoplasmic reticulum (ER) membranes, maintaining the continuous ER network. It facilitates the formation of three-way junctions where ER tubules intersect
PDB 3Q5D , 3Q5E , 3QNU , 3QOF , 4IDN , 4IDO , 4IDP , 4IDQ , 6B9D , 6B9E , 6B9F , 6B9G , 6XJN , 7OL3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02263 GBP 43 314 Guanylate-binding protein, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the adult and fetal central nervous system. Measurable expression in all tissues examined, although expression in adult brain is at least 50-fold higher than in other tissues. Detected predominantly in pyrami
Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSE
AVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERET
TGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQ
NVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRL
KVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKIL
IPWLLSPESLDIKE
INGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAV
ATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ
LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI
MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQ
AFPTPKSESTEQSEKKKM
Sequence length 558
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
34
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the nervous system Likely pathogenic rs1064795212 RCV001814486
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Accessory ectopic thyroid tissue Likely pathogenic rs1595625104 RCV001849513
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ATL1-related spastic paraplegia, recessive Pathogenic rs1316385532 RCV005253870
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Charcot-Marie-Tooth disease Pathogenic rs1555365597 RCV000789726
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal pyramidal sign Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATL1-related disorder Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acidosis Lactic Lactic acidosis Pubtator 25434004 Associate
★☆☆☆☆
Found in Text Mining only
Basal Cell Nevus Syndrome Basal cell nevus syndrome Pubtator 29081410 Associate
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 25434004 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 37551111 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 37161254 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 37161254 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy Hypertrophic Hypertrophic cardiomyopathy Pubtator 25434004 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 29128363
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 37161254 Associate
★☆☆☆☆
Found in Text Mining only
Hashimoto Disease Hashimoto disease Pubtator 37545519 Associate
★☆☆☆☆
Found in Text Mining only