Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51056
Gene name	Leucine aminopeptidase 3
Gene symbol	LAP3
Synonyms (NCBI Gene)	HEL-S-106LAPLAPEPPEPS
Chromosome	4
Chromosome location	4p15.32

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments
MIRT1103965	hsa-miR-1178	CLIP-seq
MIRT1103966	hsa-miR-153	CLIP-seq
MIRT1103967	hsa-miR-3200-5p	CLIP-seq
MIRT1103968	hsa-miR-3660	CLIP-seq
MIRT1103969	hsa-miR-384	CLIP-seq
MIRT1103970	hsa-miR-4256	CLIP-seq
MIRT1103971	hsa-miR-4272	CLIP-seq
MIRT1103972	hsa-miR-4326	CLIP-seq
MIRT1103973	hsa-miR-4328	CLIP-seq
MIRT1103974	hsa-miR-4526	CLIP-seq
MIRT1103975	hsa-miR-4682	CLIP-seq
MIRT1103976	hsa-miR-4719	CLIP-seq
MIRT1103977	hsa-miR-4729	CLIP-seq
MIRT1103978	hsa-miR-4762-3p	CLIP-seq
MIRT1103979	hsa-miR-4762-5p	CLIP-seq
MIRT1103980	hsa-miR-4775	CLIP-seq
MIRT1103981	hsa-miR-519a	CLIP-seq
MIRT1103982	hsa-miR-519b-3p	CLIP-seq
MIRT1103983	hsa-miR-519c-3p	CLIP-seq
MIRT1103984	hsa-miR-590-3p	CLIP-seq
MIRT1103967	hsa-miR-3200-5p	CLIP-seq
MIRT1103969	hsa-miR-384	CLIP-seq
MIRT1103972	hsa-miR-4326	CLIP-seq
MIRT1103975	hsa-miR-4682	CLIP-seq
MIRT1103976	hsa-miR-4719	CLIP-seq
MIRT1103979	hsa-miR-4762-5p	CLIP-seq
MIRT1103965	hsa-miR-1178	CLIP-seq
MIRT1103966	hsa-miR-153	CLIP-seq
MIRT1103973	hsa-miR-4328	CLIP-seq
MIRT1103980	hsa-miR-4775	CLIP-seq
MIRT1103981	hsa-miR-519a	CLIP-seq
MIRT1103982	hsa-miR-519b-3p	CLIP-seq
MIRT1103983	hsa-miR-519c-3p	CLIP-seq
MIRT1103984	hsa-miR-590-3p	CLIP-seq
MIRT1103965	hsa-miR-1178	CLIP-seq
MIRT1103966	hsa-miR-153	CLIP-seq
MIRT2560096	hsa-miR-3168	CLIP-seq
MIRT1103967	hsa-miR-3200-5p	CLIP-seq
MIRT2560097	hsa-miR-3609	CLIP-seq
MIRT2560098	hsa-miR-3664-5p	CLIP-seq
MIRT1103969	hsa-miR-384	CLIP-seq
MIRT2560099	hsa-miR-3976	CLIP-seq
MIRT2560100	hsa-miR-3977	CLIP-seq
MIRT2560101	hsa-miR-4282	CLIP-seq
MIRT1103972	hsa-miR-4326	CLIP-seq
MIRT1103973	hsa-miR-4328	CLIP-seq
MIRT2560102	hsa-miR-4424	CLIP-seq
MIRT2560103	hsa-miR-4476	CLIP-seq
MIRT1103975	hsa-miR-4682	CLIP-seq
MIRT2560104	hsa-miR-4714-5p	CLIP-seq
MIRT1103976	hsa-miR-4719	CLIP-seq
MIRT1103977	hsa-miR-4729	CLIP-seq
MIRT1103979	hsa-miR-4762-5p	CLIP-seq
MIRT2560105	hsa-miR-4766-5p	CLIP-seq
MIRT1103980	hsa-miR-4775	CLIP-seq
MIRT2560106	hsa-miR-4799-5p	CLIP-seq
MIRT2560107	hsa-miR-513c	CLIP-seq
MIRT2560108	hsa-miR-514b-5p	CLIP-seq
MIRT1103981	hsa-miR-519a	CLIP-seq
MIRT1103982	hsa-miR-519b-3p	CLIP-seq
MIRT1103983	hsa-miR-519c-3p	CLIP-seq
MIRT2560109	hsa-miR-548ah	CLIP-seq
MIRT2560110	hsa-miR-548c-3p	CLIP-seq
MIRT2560111	hsa-miR-548t	CLIP-seq
MIRT1103984	hsa-miR-590-3p	CLIP-seq
MIRT1103965	hsa-miR-1178	CLIP-seq
MIRT1103966	hsa-miR-153	CLIP-seq
MIRT2560096	hsa-miR-3168	CLIP-seq
MIRT1103967	hsa-miR-3200-5p	CLIP-seq
MIRT2560097	hsa-miR-3609	CLIP-seq
MIRT2560098	hsa-miR-3664-5p	CLIP-seq
MIRT1103969	hsa-miR-384	CLIP-seq
MIRT2560100	hsa-miR-3977	CLIP-seq
MIRT2560101	hsa-miR-4282	CLIP-seq
MIRT1103972	hsa-miR-4326	CLIP-seq
MIRT1103973	hsa-miR-4328	CLIP-seq
MIRT2560102	hsa-miR-4424	CLIP-seq
MIRT2560103	hsa-miR-4476	CLIP-seq
MIRT1103975	hsa-miR-4682	CLIP-seq
MIRT2560104	hsa-miR-4714-5p	CLIP-seq
MIRT1103976	hsa-miR-4719	CLIP-seq
MIRT1103977	hsa-miR-4729	CLIP-seq
MIRT1103979	hsa-miR-4762-5p	CLIP-seq
MIRT2560105	hsa-miR-4766-5p	CLIP-seq
MIRT1103980	hsa-miR-4775	CLIP-seq
MIRT2560106	hsa-miR-4799-5p	CLIP-seq
MIRT2560107	hsa-miR-513c	CLIP-seq
MIRT2560108	hsa-miR-514b-5p	CLIP-seq
MIRT1103981	hsa-miR-519a	CLIP-seq
MIRT1103982	hsa-miR-519b-3p	CLIP-seq
MIRT1103983	hsa-miR-519c-3p	CLIP-seq
MIRT2560109	hsa-miR-548ah	CLIP-seq
MIRT2560110	hsa-miR-548c-3p	CLIP-seq
MIRT2560111	hsa-miR-548t	CLIP-seq
MIRT1103984	hsa-miR-590-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	NAS	1908238
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33060197, 36217029
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	1908238
GO:0008233	Function	Peptidase activity	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008235	Function	Metalloexopeptidase activity	NAS	1908238
GO:0016787	Function	Hydrolase activity	IEA
GO:0030145	Function	Manganese ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

MIM	HGNC	e!Ensembl
170250	18449	ENSG00000002549

P28838

Protein name

Cytosol aminopeptidase (EC 3.4.11.1) (Cysteinylglycine-S-conjugate dipeptidase) (EC 3.4.13.23) (Leucine aminopeptidase 3) (LAP-3) (Leucyl aminopeptidase) (Peptidase S) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase)

Protein function

Cytosolic metallopeptidase that catalyzes the removal of unsubstituted N-terminal hydrophobic amino acids from various peptides. The presence of Zn(2+) ions is essential for the peptidase activity, and the association with other cofactors can mo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02789	Peptidase_M17_N	37 → 169	Cytosol aminopeptidase family, N-terminal domain	Domain
PF00883	Peptidase_M17	197 → 508	Cytosol aminopeptidase family, catalytic domain	Domain

Sequence

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA

Sequence length

519

Interactions

View interactions

	KEGG
	Arginine and proline metabolism Glutathione metabolism Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35008858	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30417585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26078706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26526349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25120751, 33893083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrocalcinosis 2	Chondrocalcinosis	Pubtator	35008858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26078706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36930661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25120751	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30417585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26526349, 30417585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18214604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35008858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	38509667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24477662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36519208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	6350155		★★★★★ ★☆☆☆☆ Found in Text Mining only

LAP3 (leucine aminopeptidase 3)