GMNN (geminin DNA replication inhibitor)

Gene

• Entrez ID: 51053
• Gene name: Geminin DNA replication inhibitor
• Gene symbol: GMNN
• Synonyms (NCBI Gene): Gem, MGORS6
• Chromosome: 6
• Chromosome location: 6p22.3
• Summary: This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-repli

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs864309486	A>T	Pathogenic	Stop gained, coding sequence variant, upstream transcript variant, genic upstream transcript variant
rs864309487	TCAA>-	Pathogenic	Frameshift variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant
rs864309488	A>G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant, upstream transcript variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006345	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006352	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006345	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006352	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006345	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006352	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT016570	hsa-miR-193b-3p	Microarray	20304954
MIRT029967	hsa-miR-26b-5p	Microarray	19088304
MIRT043150	hsa-miR-324-5p	CLASH	23622248
MIRT736047	hsa-miR-571	Immunoprecipitaion (IP), RNA-seq	31431461
MIRT1022703	hsa-miR-1182	CLIP-seq
MIRT1022704	hsa-miR-1256	CLIP-seq
MIRT1022705	hsa-miR-1283	CLIP-seq
MIRT1022706	hsa-miR-132	CLIP-seq
MIRT1022707	hsa-miR-155	CLIP-seq
MIRT1022708	hsa-miR-1915	CLIP-seq
MIRT1022709	hsa-miR-212	CLIP-seq
MIRT1022710	hsa-miR-221	CLIP-seq
MIRT1022711	hsa-miR-222	CLIP-seq
MIRT1022712	hsa-miR-23a	CLIP-seq
MIRT1022713	hsa-miR-23b	CLIP-seq
MIRT1022714	hsa-miR-23c	CLIP-seq
MIRT1022715	hsa-miR-3180-5p	CLIP-seq
MIRT1022716	hsa-miR-3664-5p	CLIP-seq
MIRT1022717	hsa-miR-3668	CLIP-seq
MIRT1022718	hsa-miR-3671	CLIP-seq
MIRT1022719	hsa-miR-3681	CLIP-seq
MIRT1022720	hsa-miR-376a	CLIP-seq
MIRT1022721	hsa-miR-376b	CLIP-seq
MIRT1022722	hsa-miR-376c	CLIP-seq
MIRT1022723	hsa-miR-3924	CLIP-seq
MIRT1022724	hsa-miR-4251	CLIP-seq
MIRT1022725	hsa-miR-4642	CLIP-seq
MIRT1022726	hsa-miR-4668-3p	CLIP-seq
MIRT1022727	hsa-miR-4703-3p	CLIP-seq
MIRT1022728	hsa-miR-4714-5p	CLIP-seq
MIRT1022729	hsa-miR-4715-5p	CLIP-seq
MIRT1022730	hsa-miR-4726-3p	CLIP-seq
MIRT1022731	hsa-miR-513c	CLIP-seq
MIRT1022732	hsa-miR-520a-5p	CLIP-seq
MIRT1022733	hsa-miR-520d-5p	CLIP-seq
MIRT1022734	hsa-miR-524-5p	CLIP-seq
MIRT1022735	hsa-miR-525-5p	CLIP-seq
MIRT1022736	hsa-miR-539	CLIP-seq
MIRT1022737	hsa-miR-548c-3p	CLIP-seq
MIRT1022738	hsa-miR-548v	CLIP-seq
MIRT1022739	hsa-miR-549	CLIP-seq
MIRT1022706	hsa-miR-132	CLIP-seq
MIRT1022709	hsa-miR-212	CLIP-seq
MIRT1022718	hsa-miR-3671	CLIP-seq
MIRT1022731	hsa-miR-513c	CLIP-seq
MIRT1022719	hsa-miR-3681	CLIP-seq
MIRT1022712	hsa-miR-23a	CLIP-seq
MIRT1022713	hsa-miR-23b	CLIP-seq
MIRT1022714	hsa-miR-23c	CLIP-seq
MIRT1022724	hsa-miR-4251	CLIP-seq
MIRT1022726	hsa-miR-4668-3p	CLIP-seq
MIRT1022736	hsa-miR-539	CLIP-seq
MIRT1022739	hsa-miR-549	CLIP-seq
MIRT1022703	hsa-miR-1182	CLIP-seq
MIRT1022707	hsa-miR-155	CLIP-seq
MIRT1022708	hsa-miR-1915	CLIP-seq
MIRT1022712	hsa-miR-23a	CLIP-seq
MIRT1022713	hsa-miR-23b	CLIP-seq
MIRT1022714	hsa-miR-23c	CLIP-seq
MIRT1022720	hsa-miR-376a	CLIP-seq
MIRT1022721	hsa-miR-376b	CLIP-seq
MIRT1022722	hsa-miR-376c	CLIP-seq
MIRT1022724	hsa-miR-4251	CLIP-seq
MIRT1022726	hsa-miR-4668-3p	CLIP-seq
MIRT1022730	hsa-miR-4726-3p	CLIP-seq
MIRT1022736	hsa-miR-539	CLIP-seq
MIRT1022737	hsa-miR-548c-3p	CLIP-seq
MIRT1022739	hsa-miR-549	CLIP-seq
MIRT1022703	hsa-miR-1182	CLIP-seq
MIRT1022707	hsa-miR-155	CLIP-seq
MIRT1022708	hsa-miR-1915	CLIP-seq
MIRT1022712	hsa-miR-23a	CLIP-seq
MIRT1022713	hsa-miR-23b	CLIP-seq
MIRT1022714	hsa-miR-23c	CLIP-seq
MIRT1022720	hsa-miR-376a	CLIP-seq
MIRT1022721	hsa-miR-376b	CLIP-seq
MIRT1022722	hsa-miR-376c	CLIP-seq
MIRT1022724	hsa-miR-4251	CLIP-seq
MIRT1022726	hsa-miR-4668-3p	CLIP-seq
MIRT1022730	hsa-miR-4726-3p	CLIP-seq
MIRT1022736	hsa-miR-539	CLIP-seq
MIRT1022737	hsa-miR-548c-3p	CLIP-seq
MIRT1022739	hsa-miR-549	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IDA	11125146
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	11125146, 14993212, 15232106, 16482215, 17318181, 19906994, 20932478, 21543332, 21856198, 22581055, 22615398, 23708001, 25416956, 26496610, 27107012, 27229929, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21543332, 24217620
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	19906994
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21543332
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006275	Process	Regulation of DNA replication	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	17234884
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	21543332
GO:0008156	Process	Negative regulation of DNA replication	IDA	9635433
GO:0008156	Process	Negative regulation of DNA replication	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0017053	Component	Transcription repressor complex	IPI	22615398
GO:0017053	Component	Transcription repressor complex	ISS
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	IBA
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	IDA	24064211
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	IEA
GO:0035563	Process	Positive regulation of chromatin binding	IDA	11125146
GO:0042826	Function	Histone deacetylase binding	IPI	16924111
GO:0045786	Process	Negative regulation of cell cycle	IBA
GO:0045786	Process	Negative regulation of cell cycle	IDA	9635433, 19906994
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	NAS	22615398
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16924111
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0071163	Process	DNA replication preinitiation complex assembly	IDA	11125146
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:2000104	Process	Negative regulation of DNA-templated DNA replication	IDA	11125146, 19906994

Other IDs

• MIM: 602842
• HGNC: 17493
• e!Ensembl: ENSG00000112312

Protein

• UniProt ID: O75496
• Protein name: Geminin
• Protein function: Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC) (PubMed:14993212, PubMed:20129055, PubMed:24064211, PubMed:9635433). It is degraded during the mitotic phase of the cell cycle (PubMed:
• PDB: 1T6F, 1UII, 2LP0, 2WVR, 4BRY, 7KLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07412	Geminin	1 → 184	Geminin	Family

• Sequence:

  MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
  TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL
  HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET
  VEDSLVEDSEIGTCAEGTVSSSTDAKPCI

• Sequence length: 209

Pathways

Reactome:

CDT1 association with the CDC6:ORC:origin complex
Activation of the pre-replicative complex

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Meier-Gorlin syndrome	Pathogenic; Likely pathogenic	rs864309486, rs864309487, rs864309488	RCV000202433 RCV000202431 RCV000202432	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Meier-Gorlin syndrome 6	Pathogenic; Likely pathogenic	rs864309486, rs864309487, rs864309488	RCV000208589 RCV000208583 RCV000208587	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR-PATELLA-SHORT STATURE SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GMNN-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20035856		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17555452, 20581313, 24755352, 25115891, 29907809, 31089287		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28650455		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31248612		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28425853		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	27879189, 28422841		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36539849	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20581313, 24755352		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	17476328		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18515573		★☆☆☆☆ Found in Text Mining only
Amyloid nephropathy	Amyloid Nephropathy	BEFREE	26574972		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26574972		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29159928		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	19920109	Stimulate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21595939	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	18297378, 18638658, 19019897, 19496308, 20652381, 21797986, 22744805, 23697859, 25491925, 26238044, 26996109, 30398028, 30892832		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28064436		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	16263420, 21561401		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26574972		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	17388919		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	28690291		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11407943		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17262828	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28627421		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22884899		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	31887354	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	26744892, 26890333		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15809348, 17445178, 18340360, 20035856, 20371502, 20722764, 20826009, 22768326, 23952617, 24529855, 25069714, 25581336, 26142251, 26495028, 29395276, 30232844		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	21726204		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12209364, 17868255, 19405872, 23697859, 28862099, 31849952		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	31229495		★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	BEFREE	18340360, 21595535		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25175477		★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	21561401		★☆☆☆☆ Found in Text Mining only
Brachydactyly type C	Brachydactyly	BEFREE	31229495		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15376260, 15389519, 16919268, 21479698, 22184288, 23792055, 27631728, 28288134, 28436938, 28650472, 31068665		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16278669, 24789045, 26205655, 28886153, 40141282	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15682442		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24980480	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34238253	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25175477		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12063551		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15814627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26744525		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17947481		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17215859, 22180175, 26334461		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30995924		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15730517, 28658133		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20581313, 24518758, 24755352, 26472014		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31229495		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23777934		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21726204		★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	25193965		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	GENOMICS_ENGLAND_DG	26637980		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16629645, 21920398, 29149205, 29354127		★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	31229495		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29952003		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26181663, 26383988, 27519478, 28088355		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25634203	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25860853		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	19118512, 29045069		★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital absence of breast	Breast aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital absence of external ear	Anotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital absence of mandible	Mandibular aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19789864, 26542067, 29649328, 29869094, 31194766		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	23370861		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23831511		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	22768326		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21281981		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15607798, 16698433, 17130561, 17174747, 17445178, 17990989, 19120281, 19392800, 20580654, 22069276, 26031759, 26334461, 26991115, 29384924		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17145370, 18632158, 21281981, 30809938		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	19293805	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24755352		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	16924111		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	26637980		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	GENOMICS_ENGLAND_DG	26637980		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	26637980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	CLINVAR_DG	26637980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	ORPHANET_DG	26637980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ear-patella-short stature syndrome	Ear-Patella-Short Stature Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eclampsia	Eclampsia	BEFREE	25561558		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23831511		★☆☆☆☆ Found in Text Mining only
Entropion	Entropion	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Entropion	Entropion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	23266622		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17262828	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	14989709, 17378893, 17445182, 17998861, 20860769, 25960307, 27394130, 29907809, 30265752, 30787107		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24852304		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24174177		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18347914, 19169284, 19500138, 19857587, 30168290		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17476328		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26444025	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27879189, 29105364		★☆☆☆☆ Found in Text Mining only
Hypertrophy of clitoris	Hypertrophy Of Clitoris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28205529		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24571473, 25792670		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27930093		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20036705, 29869094		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30995924		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	24112428		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	27059715		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26989167		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27879189		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23777934		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28032719		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	23178314, 25991737	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	22031078, 25117794		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17060849, 17445182, 18555529, 19450876, 21479698, 23014531, 26416275, 26495028, 27695964, 28202613, 28466469, 28520526, 31379844		★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	12750175, 16263420, 20410181		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17825623, 17998861, 18347914, 20302958, 20581313, 22931314, 24755352, 25636577, 25960307, 26415557, 28111167, 28650455, 29549293, 31644966		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29703335, 30358213		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28135012		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16629645, 22912832, 23150500, 25700262, 29149205, 30779432		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16629645		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16629645, 21920398, 29149205, 29354127		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19675166, 20035856, 29066026		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19675166, 20035856, 29066026		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17445179, 19675166, 19926642, 20035856, 21233146, 25581336, 26960450, 26989167, 28272205, 29066026, 29395276		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19675166, 20035856, 29066026		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20207982, 26495028		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	23644024		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	25700262		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15376260, 15389519, 16278669, 16919268, 21479698, 22184288, 23792055, 27631728, 28288134, 28436938, 28650472, 28886153, 31068665		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29149205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12063551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28135012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18404646, 26124331, 29928962, 30323973, 31382681		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22487023, 25381262		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	26744525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29666399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22836040		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25175477		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10570186, 12063551, 14751840, 15291814, 15389519, 15809348, 17378893, 17493020, 18508524, 20136698, 20302958, 22836040, 22912832, 25175477, 25617806, 26202659, 26374324, 26495028, 27253410, 27394130, 27702582, 27821018, 28125050, 29105756, 30168290, 30999154		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29952003		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22184288		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17036332		★☆☆☆☆ Found in Text Mining only
MEIER-GORLIN SYNDROME 6	Meier-Gorlin Syndrome	GENOMICS_ENGLAND_DG	26637980, 30914295		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MEIER-GORLIN SYNDROME 6	Meier-Gorlin Syndrome	UNIPROT_DG	26637980		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MEIER-GORLIN SYNDROME 6	Meier-Gorlin Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	BEFREE	15248031, 20721616, 23370861		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17597816, 22652151	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	10449117		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	27760759		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	18263639, 19527230, 19875891, 22669573, 28923404		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28135012	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	24119562		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18443352, 28111466, 29099494, 30192814		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16005084, 19421224, 19630074, 20826009, 21665278, 24529855, 25037176, 26142251, 26866467, 29159928, 29307888, 31846493		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31846493		★☆☆☆☆ Found in Text Mining only
MUNGAN SYNDROME	MUNGAN SYNDROME	BEFREE	26637980, 29036220		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	14625404		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16263420, 25960307, 27760759		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15973179, 18555529, 22842045, 22923051, 24755352, 25077441		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	21281981		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16284396		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12063551, 14712211, 15389519, 15682442, 15730517, 16278669, 17947481, 19240714, 19920109, 22184288, 22836040, 22912832, 25175477, 25615572, 26372424, 27253410, 28188495, 28445952, 28886153, 29649635, 29731605, 29745471, 29928962, 29952003, 31229495, 31844158		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26202659		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28557659		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	23099891		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29703335, 30358213		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22836042, 29066508, 29731605, 30765392		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18632158, 31013288		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31013288	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	26989167		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37794464	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37794464	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36807748	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36807748	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18404646, 26124331, 29928962, 30323973, 31382681		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18404646		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28142123		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22159556, 28152544	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	16263420		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	31754096	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	15730517		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	16263420, 21561401, 22803950		★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	22768326, 25867094		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	22768326		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25228523		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25228523		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29703335		★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism 1	Pituitary dwarfism	Pubtator	26637980	Associate	★☆☆☆☆ Found in Text Mining only
PITUITARY DWARFISM I	Pituitary dwarfism	BEFREE	26637980		★☆☆☆☆ Found in Text Mining only
PITUITARY DWARFISM I	Pituitary dwarfism	GENOMICS_ENGLAND_DG	26637980		★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	25115891, 29907809		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22487023, 25381262		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17406359, 30905848	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	21931540, 30932338		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16829306, 29943154		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	15140215, 18643961, 21867738		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34250093	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	15389519		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16641046, 17498267, 17882223, 21373785, 22960345, 24912006, 25069714, 26187163, 30696403, 31284249		★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	25991737	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	15146426		★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	GENOMICS_ENGLAND_DG	26637980		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24497922, 30796344		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28213050		★☆☆☆☆ Found in Text Mining only
Simple syndactyly of toes, first web space	Syndactyly	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	19731638, 21595535		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20136698, 24818561, 26744525, 28445952, 29745471		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19293805, 27584664, 28032719, 31391008	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18302964		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27584664, 29408295, 30828910		★☆☆☆☆ Found in Text Mining only
Stenosis of external auditory canal	Stenosis Of External Auditory Canal	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Stenosis of external auditory canal	Stenosis Of External Auditory Canal	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29666399		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Submucous cleft of hard palate	Submucosal cleft palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15146426, 17445179, 20082621, 26960450, 28120169		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	27821018		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22836040		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22836040		★☆☆☆☆ Found in Text Mining only
Tracheomalacia	Tracheomalacia	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	25561558		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24789045	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31844158		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29649328, 29869094		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	CLINVAR_DG	26637980		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25175477	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27879189		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	28658133	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	21595535		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	18571006, 22219647		★☆☆☆☆ Found in Text Mining only