Gene Gene information from NCBI Gene database.
Entrez ID 51050
Gene name Peptidase inhibitor 15
Gene symbol PI15
Synonyms (NCBI Gene)
CRISP8P24TIP25TI
Chromosome 8
Chromosome location 8q21.13
Summary This gene encodes a trypsin inhibitor. The protein shares similarity to insect venom allergens, mammalian testis-specific proteins and plant pathogenesis-related proteins. It is frequently expressed in human neuroblastoma and glioblastoma cell lines, and
miRNA miRNA information provided by mirtarbase database.
173
miRTarBase ID miRNA Experiments Reference
MIRT1232610 hsa-miR-105 CLIP-seq
MIRT1232611 hsa-miR-1256 CLIP-seq
MIRT1232612 hsa-miR-1261 CLIP-seq
MIRT1232613 hsa-miR-141 CLIP-seq
MIRT1232614 hsa-miR-146a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0030414 Function Peptidase inhibitor activity IEA
GO:0070062 Component Extracellular exosome HDA 23533145
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607076 8946 ENSG00000137558
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43692
Protein name Peptidase inhibitor 15 (PI-15) (25 kDa trypsin inhibitor) (p25TI) (Cysteine-rich secretory protein 8) (CRISP-8) (SugarCrisp)
Protein function Serine protease inhibitor which displays weak inhibitory activity against trypsin (PubMed:8882727). May play a role in facial patterning during embryonic development (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00188 CAP 71 211 Cysteine-rich secretory protein family Domain
Tissue specificity TISSUE SPECIFICITY: Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland. {ECO:0000269|PubMed:11287197, ECO:0000269|PubMed:9473672}.
Sequence
MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR
YISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF
LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWAT
SNRIGCAIHTCQNMNVWGSVWRRAVYLVCNY
APKGNWIGEAPYKVGVPCSSCPPSYGGSC
TDNLCFPGVTSNYLYWFK
Sequence length 258
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLON CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bladder Neoplasm Bladder Neoplasm BEFREE 29928337
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 29928337
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma BEFREE 30638862
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 30638862 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 25117815 Associate
★☆☆☆☆
Found in Text Mining only
Congenital contractural arachnodactyly Congenital Contractural Arachnodactyly BEFREE 30638862
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 9473672
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 9473672
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 30638862
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of urinary bladder Urinary bladder cancer BEFREE 29928337
★☆☆☆☆
Found in Text Mining only