Gene Gene information from NCBI Gene database.
Entrez ID 51035
Gene name UBX domain protein 1
Gene symbol UBXN1
Synonyms (NCBI Gene)
2B28SAKS1UBXD10
Chromosome 11
Chromosome location 11q12.3
miRNA miRNA information provided by mirtarbase database.
29
miRTarBase ID miRNA Experiments Reference
MIRT003817 hsa-miR-373-3p Microarray 15685193
MIRT020578 hsa-miR-155-5p Proteomics 18668040
MIRT047839 hsa-miR-30c-5p CLASH 23622248
MIRT046169 hsa-miR-27b-3p CLASH 23622248
MIRT044114 hsa-miR-30e-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 18775313, 20351172, 25416956, 32296183, 32814053, 37776851
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616378 18402 ENSG00000162191
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04323
Protein name UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein)
Protein function Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00627 UBA 3 39 UBA/TS-N domain Domain
PF00789 UBX 208 293 UBX domain Domain
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAK
KCPS
Sequence length 297
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum   N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Colon adenocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Glioma Glioma BEFREE 27998759
★☆☆☆☆
Found in Text Mining only
Hereditary Diffuse Gastric Cancer Gastric Cancer CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach Neoplasms CTD_human_DG 21364753
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Vesicular Stomatitis Vesicular stomatitis Pubtator 23545497 Associate
★☆☆☆☆
Found in Text Mining only