CELA2B (chymotrypsin like elastase 2B)

Gene

• Entrez ID: 51032
• Gene name: Chymotrypsin like elastase 2B
• Gene symbol: CELA2B
• Synonyms (NCBI Gene): ELA2B
• Chromosome: 1
• Chromosome location: 1p36.21
• Summary: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT883633	hsa-miR-132	CLIP-seq
MIRT883634	hsa-miR-153	CLIP-seq
MIRT883635	hsa-miR-1915	CLIP-seq
MIRT883636	hsa-miR-212	CLIP-seq
MIRT883637	hsa-miR-3691-3p	CLIP-seq
MIRT883638	hsa-miR-369-3p	CLIP-seq
MIRT883639	hsa-miR-374a	CLIP-seq
MIRT883640	hsa-miR-374b	CLIP-seq
MIRT883641	hsa-miR-410	CLIP-seq
MIRT883642	hsa-miR-448	CLIP-seq
MIRT883643	hsa-miR-4726-3p	CLIP-seq
MIRT883644	hsa-miR-4766-5p	CLIP-seq
MIRT883645	hsa-miR-494	CLIP-seq
MIRT883646	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS	3427074
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	3646943
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 609444
• HGNC: 29995
• e!Ensembl: ENSG00000215704

Protein

• UniProt ID: P08218
• Protein name: Chymotrypsin-like elastase family member 2B (EC 3.4.21.71) (Elastase-2B)
• Protein function: Acts upon elastin.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	29 → 262	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Pancreas.
• Sequence:

  MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGG
  SLIANSWVLTAAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGN
  DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGQLLV
  VDYATCSSSGWWGSTVKTNMICAGGDGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSV
  LGCNYYYKPSIFTRVSNYNDWINSVIANN

• Sequence length: 269

Pathways

KEGG:

Pancreatic secretion
Protein digestion and absorption

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ERECTILE DYSFUNCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations