Gene Gene information from NCBI Gene database.
Entrez ID 51021
Gene name Mitochondrial ribosomal protein S16
Gene symbol MRPS16
Synonyms (NCBI Gene)
CGI-132COXPD2MRP-S16RPMS16S16mtbS16m
Chromosome 10
Chromosome location 10q22.2
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
1044
miRTarBase ID miRNA Experiments Reference
MIRT029903 hsa-miR-26b-5p Microarray 19088304
MIRT048083 hsa-miR-197-3p CLASH 23622248
MIRT047902 hsa-miR-30c-5p CLASH 23622248
MIRT045285 hsa-miR-186-5p CLASH 23622248
MIRT037587 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0003735 Function Structural constituent of ribosome ISS 11402041
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005515 Function Protein binding IPI 19945174
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609204 14048 ENSG00000182180
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3D3
Protein name Small ribosomal subunit protein bS16m (28S ribosomal protein S16, mitochondrial) (MRP-S16) (S16mt)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00886 Ribosomal_S16 24 84 Ribosomal protein S16 Family
Sequence
MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS
HGEKLVALNLDRIRHWIGCGAHLS
KPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL
ASQKTDAEATDTEATET
Sequence length 137
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome   Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
17
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Combined oxidative phosphorylation defect type 2 Uncertain significance; Conflicting classifications of pathogenicity ClinVar
ClinVar, GWAS catalog, Orphanet
ClinVar, GWAS catalog, Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Combined oxidative phosphorylation deficiency Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Brachydactyly Brachydactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
Combined oxidative phosphorylation defect type 2 Combined Oxidative Phosphorylation Deficiency Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Combined Oxidative Phosphorylation Deficiency 2 Combined Oxidative Phosphorylation Deficiency ORPHANET_DG 15505824
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 2 Combined Oxidative Phosphorylation Deficiency GENOMICS_ENGLAND_DG 15505824, 18539099, 21169334, 25655951
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 2 Combined Oxidative Phosphorylation Deficiency CTD_human_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 2 Combined Oxidative Phosphorylation Deficiency CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases Mitochondrial disease Pubtator 21169334 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Neonatal Hypotonia Hypotonia HPO_DG
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 33934540 Associate
★☆☆☆☆
Found in Text Mining only