Gene Gene information from NCBI Gene database.
Entrez ID 51013
Gene name Exosome component 1
Gene symbol EXOSC1
Synonyms (NCBI Gene)
CGI-108CSL4Csl4pPCH1FSKI4Ski4pp13
Chromosome 10
Chromosome location 10q24.1
Summary This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein i
miRNA miRNA information provided by mirtarbase database.
79
miRTarBase ID miRNA Experiments Reference
MIRT050366 hsa-miR-24-3p CLASH 23622248
MIRT046834 hsa-miR-222-3p CLASH 23622248
MIRT043724 hsa-miR-342-3p CLASH 23622248
MIRT973055 hsa-miR-103a CLIP-seq
MIRT973056 hsa-miR-106a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000176 Component Nuclear exosome (RNase complex) IBA
GO:0000176 Component Nuclear exosome (RNase complex) NAS 20531386
GO:0000177 Component Cytoplasmic exosome (RNase complex) NAS 20531386
GO:0000178 Component Exosome (RNase complex) IDA 20531389
GO:0000178 Component Exosome (RNase complex) IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606493 17286 ENSG00000171311
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3B2
Protein name Exosome complex component CSL4 (Exosome component 1)
Protein function Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturat
PDB 2NN6 , 6D6Q , 6D6R , 6H25 , 9G8M , 9G8N , 9G8O , 9G8P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14382 ECR1_N 8 43 Exosome complex exonuclease RRP4 N-terminal region Domain
PF10447 EXOSC1 89 135 Exosome component EXOSC1/CSL4 Domain
Sequence
MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETE
SQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYK
SFRPGDIVLAKVISL
GDAQSNYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTK
EFRKVARVQPEFLQT
Sequence length 195
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  RNA degradation   ATF4 activates genes in response to endoplasmic reticulum stress
mRNA decay by 3' to 5' exoribonuclease
Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA
Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA
KSRP (KHSRP) binds and destabilizes mRNA
Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Pontocerebellar hypoplasia, type 1F Pathogenic rs2133168246 RCV001380415
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
VASCULAR BRAIN INJURY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 27876072 Associate
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory Bowel Disease BEFREE 22488912
★☆☆☆☆
Found in Text Mining only
Pontocerebellar Hypoplasia Pontocerebellar hypoplasia Pubtator 37024942 Associate
★☆☆☆☆
Found in Text Mining only
Pontocerebellar Hypoplasia Type 1 Pontocerebellar hypoplasia Pubtator 37024942 Associate
★☆☆☆☆
Found in Text Mining only
Rheumatoid Arthritis Rheumatoid arthritis BEFREE 27876072
★☆☆☆☆
Found in Text Mining only