Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51003
Gene name	Mediator complex subunit 31
Gene symbol	MED31
Synonyms (NCBI Gene)	3110004H13RikCGI-125SEP10Soh1
Chromosome	17
Chromosome location	17p13.1

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029312	hsa-miR-26b-5p	Microarray	19088304
MIRT1141722	hsa-miR-1208	CLIP-seq
MIRT1141723	hsa-miR-1282	CLIP-seq
MIRT1141724	hsa-miR-129-5p	CLIP-seq
MIRT1141725	hsa-miR-145	CLIP-seq
MIRT1141726	hsa-miR-302a	CLIP-seq
MIRT1141727	hsa-miR-302b	CLIP-seq
MIRT1141728	hsa-miR-302c	CLIP-seq
MIRT1141729	hsa-miR-302d	CLIP-seq
MIRT1141730	hsa-miR-302e	CLIP-seq
MIRT1141731	hsa-miR-3149	CLIP-seq
MIRT1141732	hsa-miR-323-3p	CLIP-seq
MIRT1141733	hsa-miR-3713	CLIP-seq
MIRT1141734	hsa-miR-372	CLIP-seq
MIRT1141735	hsa-miR-373	CLIP-seq
MIRT1141736	hsa-miR-412	CLIP-seq
MIRT1141737	hsa-miR-4328	CLIP-seq
MIRT1141738	hsa-miR-4420	CLIP-seq
MIRT1141739	hsa-miR-4477a	CLIP-seq
MIRT1141740	hsa-miR-4528	CLIP-seq
MIRT1141741	hsa-miR-4666-5p	CLIP-seq
MIRT1141742	hsa-miR-511	CLIP-seq
MIRT1141743	hsa-miR-515-3p	CLIP-seq
MIRT1141744	hsa-miR-519a	CLIP-seq
MIRT1141745	hsa-miR-519b-3p	CLIP-seq
MIRT1141746	hsa-miR-519c-3p	CLIP-seq
MIRT1141747	hsa-miR-519e	CLIP-seq
MIRT1141748	hsa-miR-520a-3p	CLIP-seq
MIRT1141749	hsa-miR-520b	CLIP-seq
MIRT1141750	hsa-miR-520c-3p	CLIP-seq
MIRT1141751	hsa-miR-520d-3p	CLIP-seq
MIRT1141752	hsa-miR-520e	CLIP-seq
MIRT2040291	hsa-miR-345	CLIP-seq
MIRT2040292	hsa-miR-4522	CLIP-seq
MIRT2270050	hsa-miR-136	CLIP-seq
MIRT2270051	hsa-miR-2276	CLIP-seq
MIRT2270052	hsa-miR-330-3p	CLIP-seq
MIRT2270053	hsa-miR-4772-3p	CLIP-seq
MIRT2270054	hsa-miR-518a-5p	CLIP-seq
MIRT2270055	hsa-miR-520d-5p	CLIP-seq
MIRT2270056	hsa-miR-524-5p	CLIP-seq
MIRT2270057	hsa-miR-527	CLIP-seq
MIRT2270058	hsa-miR-579	CLIP-seq
MIRT2453907	hsa-miR-1	CLIP-seq
MIRT2453908	hsa-miR-1200	CLIP-seq
MIRT2453909	hsa-miR-1236	CLIP-seq
MIRT2453910	hsa-miR-1247	CLIP-seq
MIRT2453911	hsa-miR-1248	CLIP-seq
MIRT2453912	hsa-miR-1252	CLIP-seq
MIRT2453913	hsa-miR-1301	CLIP-seq
MIRT2453914	hsa-miR-140-3p	CLIP-seq
MIRT2453915	hsa-miR-197	CLIP-seq
MIRT2453916	hsa-miR-2052	CLIP-seq
MIRT2453917	hsa-miR-206	CLIP-seq
MIRT2453918	hsa-miR-2116	CLIP-seq
MIRT2453919	hsa-miR-3127-3p	CLIP-seq
MIRT2453920	hsa-miR-3150a-5p	CLIP-seq
MIRT2453921	hsa-miR-3150b-5p	CLIP-seq
MIRT2453922	hsa-miR-3163	CLIP-seq
MIRT2040291	hsa-miR-345	CLIP-seq
MIRT2453923	hsa-miR-3662	CLIP-seq
MIRT2453924	hsa-miR-3663-3p	CLIP-seq
MIRT2453925	hsa-miR-3668	CLIP-seq
MIRT2453926	hsa-miR-3673	CLIP-seq
MIRT2453927	hsa-miR-3680	CLIP-seq
MIRT2453928	hsa-miR-4324	CLIP-seq
MIRT1141737	hsa-miR-4328	CLIP-seq
MIRT2453929	hsa-miR-450b-5p	CLIP-seq
MIRT2040292	hsa-miR-4522	CLIP-seq
MIRT2453930	hsa-miR-4660	CLIP-seq
MIRT2453931	hsa-miR-4661-5p	CLIP-seq
MIRT2453932	hsa-miR-4742-5p	CLIP-seq
MIRT2453933	hsa-miR-4753-3p	CLIP-seq
MIRT2453934	hsa-miR-4768-5p	CLIP-seq
MIRT2453935	hsa-miR-4798-3p	CLIP-seq
MIRT2453936	hsa-miR-5047	CLIP-seq
MIRT2453937	hsa-miR-507	CLIP-seq
MIRT2453938	hsa-miR-544b	CLIP-seq
MIRT2453939	hsa-miR-557	CLIP-seq
MIRT2453940	hsa-miR-580	CLIP-seq
MIRT2453941	hsa-miR-613	CLIP-seq
MIRT2453942	hsa-miR-624	CLIP-seq
MIRT2453907	hsa-miR-1	CLIP-seq
MIRT2453911	hsa-miR-1248	CLIP-seq
MIRT2453912	hsa-miR-1252	CLIP-seq
MIRT2453915	hsa-miR-197	CLIP-seq
MIRT2453917	hsa-miR-206	CLIP-seq
MIRT2453919	hsa-miR-3127-3p	CLIP-seq
MIRT2453920	hsa-miR-3150a-5p	CLIP-seq
MIRT2453921	hsa-miR-3150b-5p	CLIP-seq
MIRT2453925	hsa-miR-3668	CLIP-seq
MIRT2453926	hsa-miR-3673	CLIP-seq
MIRT2453941	hsa-miR-613	CLIP-seq
MIRT2453907	hsa-miR-1	CLIP-seq
MIRT2453909	hsa-miR-1236	CLIP-seq
MIRT2453910	hsa-miR-1247	CLIP-seq
MIRT2453911	hsa-miR-1248	CLIP-seq
MIRT2453912	hsa-miR-1252	CLIP-seq
MIRT2453914	hsa-miR-140-3p	CLIP-seq
MIRT2453915	hsa-miR-197	CLIP-seq
MIRT2453917	hsa-miR-206	CLIP-seq
MIRT2453918	hsa-miR-2116	CLIP-seq
MIRT2453919	hsa-miR-3127-3p	CLIP-seq
MIRT2453920	hsa-miR-3150a-5p	CLIP-seq
MIRT2453921	hsa-miR-3150b-5p	CLIP-seq
MIRT2040291	hsa-miR-345	CLIP-seq
MIRT2453925	hsa-miR-3668	CLIP-seq
MIRT2453926	hsa-miR-3673	CLIP-seq
MIRT2453927	hsa-miR-3680	CLIP-seq
MIRT1141737	hsa-miR-4328	CLIP-seq
MIRT2040292	hsa-miR-4522	CLIP-seq
MIRT2453931	hsa-miR-4661-5p	CLIP-seq
MIRT2453932	hsa-miR-4742-5p	CLIP-seq
MIRT2453933	hsa-miR-4753-3p	CLIP-seq
MIRT2453934	hsa-miR-4768-5p	CLIP-seq
MIRT2453935	hsa-miR-4798-3p	CLIP-seq
MIRT2453941	hsa-miR-613	CLIP-seq
MIRT2453942	hsa-miR-624	CLIP-seq
MIRT2453909	hsa-miR-1236	CLIP-seq
MIRT2453910	hsa-miR-1247	CLIP-seq
MIRT2453914	hsa-miR-140-3p	CLIP-seq
MIRT2453916	hsa-miR-2052	CLIP-seq
MIRT2040291	hsa-miR-345	CLIP-seq
MIRT2453927	hsa-miR-3680	CLIP-seq
MIRT1141737	hsa-miR-4328	CLIP-seq
MIRT2040292	hsa-miR-4522	CLIP-seq
MIRT2453931	hsa-miR-4661-5p	CLIP-seq
MIRT2453932	hsa-miR-4742-5p	CLIP-seq
MIRT2453933	hsa-miR-4753-3p	CLIP-seq
MIRT2453934	hsa-miR-4768-5p	CLIP-seq
MIRT2453935	hsa-miR-4798-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	15383276, 20211142, 24981860, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060173	Process	Limb development	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070847	Component	Core mediator complex	IBA
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
620492	24260	ENSG00000108590

Q9Y3C7

Protein name

Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1)

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05669	Med31	15 → 109	SOH1	Family

Sequence

MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKD
PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA
EQQQQNNTSGK

Sequence length

131

Interactions

View interactions

	Reactome
			PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24101134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24969180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	36951526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MED31 (mediator complex subunit 31)