FOXP3 (forkhead box P3)

Gene

• Entrez ID: 50943
• Gene name: Forkhead box P3
• Gene symbol: FOXP3
• Synonyms (NCBI Gene): AIID, DIETER, IPEX, JM2, PIDX, XPID
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoim

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs17847095	C>A	Pathogenic, benign	Coding sequence variant, missense variant
rs28935477	G>A	Pathogenic	Coding sequence variant, missense variant
rs122467169	A>C	Pathogenic	Coding sequence variant, missense variant
rs122467170	C>T	Pathogenic	Coding sequence variant, missense variant
rs122467171	CCT>-	Pathogenic	Coding sequence variant, inframe deletion
rs122467172	AA>GC	Pathogenic	Coding sequence variant, missense variant
rs122467173	A>G	Pathogenic	Coding sequence variant, missense variant
rs122467174	C>T	Pathogenic	Coding sequence variant, initiator codon variant, missense variant
rs122467175	A>G	Pathogenic	Coding sequence variant, missense variant
rs782377881	G>A,T	Likely-pathogenic	Stop gained, coding sequence variant, synonymous variant
rs782511378	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs782528935	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs797045588	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041596	C>A,G	Likely-pathogenic, pathogenic	Splice donor variant
rs886044787	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1057517736	G>A	Pathogenic	Coding sequence variant, stop gained
rs1057518281	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520529	C>T	Pathogenic	Missense variant, coding sequence variant
rs1064795069	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1426535368	T>A,C	Pathogenic	Intron variant
rs1557115532	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1557115786	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1557116163	TCT>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1569529565	ACA>G	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1569529715	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1602679037	AG>-	Pathogenic	Terminator codon variant, frameshift variant
rs1602679681	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1602684221	C>T	Likely-pathogenic	Splice acceptor variant
rs1602684496	G>T	Pathogenic	Coding sequence variant, missense variant
rs1602693008	C>A	Pathogenic	Genic upstream transcript variant, splice donor variant, upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001180	hsa-miR-31-5p	qRT-PCR, Luciferase reporter assay, Western blot	19408243
MIRT001180	hsa-miR-31-5p	Luciferase reporter assay	19408243
MIRT001180	hsa-miR-31-5p	qRT-PCR	24855107
MIRT001180	hsa-miR-31-5p	qRT-PCR	24855107
MIRT731428	rno-miR-125a-5p	Luciferase reporter assay	26875774
MIRT731428	rno-miR-125a-5p	Luciferase reporter assay	26875774
MIRT733221	hsa-miR-150-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, Western blotting	33723215
MIRT734339	hsa-miR-23a-3p	Microarray, qRT-PCR	31611205
MIRT734340	hsa-miR-34a-5p	Microarray, qRT-PCR	31611205
MIRT734878	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT736780	hsa-miR-155-3p	qRT-PCR	32366887
MIRT1003495	hsa-miR-1200	CLIP-seq
MIRT1003496	hsa-miR-4324	CLIP-seq
MIRT1003497	hsa-miR-4330	CLIP-seq
MIRT1003498	hsa-miR-544b	CLIP-seq
MIRT2449874	hsa-miR-1272	CLIP-seq
MIRT2449875	hsa-miR-1275	CLIP-seq
MIRT2449876	hsa-miR-1322	CLIP-seq
MIRT2449877	hsa-miR-3201	CLIP-seq
MIRT2449878	hsa-miR-4525	CLIP-seq
MIRT2449879	hsa-miR-4665-5p	CLIP-seq
MIRT2449880	hsa-miR-4723-5p	CLIP-seq
MIRT2449881	hsa-miR-4728-5p	CLIP-seq
MIRT2449882	hsa-miR-4791	CLIP-seq
MIRT2449883	hsa-miR-625	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Repression	18641303
MSC	Activation	19561533
NFATC2	Activation	16517728
NFKB1	Activation	20462637
PGR	Repression	18685848
RELA	Activation	20462637
RELA	Unknown	23178569
SIRT1	Unknown	21533107
SMAD3	Activation	20937549
SP3	Repression	20462637
STAT1	Unknown	19124747
VDR	Unknown	22529297

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19276356
GO:0001782	Process	B cell homeostasis	IEA
GO:0001818	Process	Negative regulation of cytokine production	IDA	11483607
GO:0002262	Process	Myeloid cell homeostasis	IEA
GO:0002361	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0002362	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment	TAS	18368049
GO:0002456	Process	T cell mediated immunity	IEA
GO:0002507	Process	Tolerance induction	IEA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002517	Process	T cell tolerance induction	IEA
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002666	Process	Positive regulation of T cell tolerance induction	IEA
GO:0002667	Process	Regulation of T cell anergy	IEA
GO:0002667	Process	Regulation of T cell anergy	ISS
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0002677	Process	Negative regulation of chronic inflammatory response	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IDA	15466453
GO:0002725	Process	Negative regulation of T cell cytokine production	IMP	23169781
GO:0002851	Process	Positive regulation of peripheral T cell tolerance induction	IEA
GO:0002870	Process	T cell anergy	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	21458306
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11483607, 32644293
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11138001
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	16652169, 17360565, 17377532, 18354202, 18368049, 20676092, 23396208, 23543754, 23973223, 24012345, 25096571, 25416956, 25910212, 29892012, 30510991, 31515488, 32296183, 32644293, 34019767
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	32644293
GO:0005634	Component	Nucleus	IDA	11483607, 16873067, 16920951, 22678915, 24012345
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	16903909
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22678915
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	16903909
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	NAS	16903909
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11138001
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15652505
GO:0009615	Process	Response to virus	IEP	20583921
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014045	Process	Establishment of endothelial blood-brain barrier	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16652169
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IDA	15466453
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IMP	23169781
GO:0032693	Process	Negative regulation of interleukin-10 production	IDA	15466453
GO:0032693	Process	Negative regulation of interleukin-10 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IMP	18368049
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	15466453, 17360565, 17377532
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	16873067, 23169781
GO:0032713	Process	Negative regulation of interleukin-4 production	IDA	15466453
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032714	Process	Negative regulation of interleukin-5 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032792	Process	Negative regulation of CREB transcription factor activity	IDA	16652169
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	TAS	18368049
GO:0032905	Process	Transforming growth factor beta1 production	IEA
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0032991	Component	Protein-containing complex	NAS	16903909
GO:0033080	Process	Immature T cell proliferation in thymus	IEA
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IEA
GO:0035035	Function	Histone acetyltransferase binding	IPI	17360565
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IDA	15466453
GO:0042110	Process	T cell activation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	15466453
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	21458306, 23169781
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	21458306
GO:0042803	Function	Protein homodimerization activity	IPI	16920951
GO:0042826	Function	Histone deacetylase binding	IPI	17360565
GO:0043029	Process	T cell homeostasis	NAS	11483607
GO:0043367	Process	CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	16873067
GO:0043565	Function	Sequence-specific DNA binding	IDA	11483607, 16873067, 19276356
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IDA	30513302
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11483607, 16920951, 17360565, 22678915
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	21458306, 23169781
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15466453
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	21458306, 23169781
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19276356
GO:0046007	Process	Negative regulation of activated T cell proliferation	NAS	11483607
GO:0046633	Process	Alpha-beta T cell proliferation	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048289	Process	Isotype switching to IgE isotypes	IEA
GO:0048294	Process	Negative regulation of isotype switching to IgE isotypes	IEA
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	IEA
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050777	Process	Negative regulation of immune response	IDA	15652505
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0051059	Function	NF-kappaB binding	NAS	16652169
GO:0051525	Function	NFAT protein binding	IPI	16873067, 21458306
GO:1901355	Process	Response to rapamycin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IMP	23169781
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IEA

Other IDs

• MIM: 300292
• HGNC: 6106
• e!Ensembl: ENSG00000049768

Protein

• UniProt ID: Q9BZS1
• Protein name: Forkhead box protein P3 (Scurfin) [Cleaved into: Forkhead box protein P3, C-terminally processed; Forkhead box protein P3 41 kDa form]
• Protein function: Transcriptional regulator which is crucial for the development and inhibitory function of regulatory T-cells (Treg) (PubMed:17377532, PubMed:21458306, PubMed:23947341, PubMed:24354325, PubMed:24722479, PubMed:24835996, PubMed:30513302, PubMed:32
• PDB: 3QRF, 4WK8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16159	FOXP-CC	193 → 261	FOXP coiled-coil domain	Domain
  PF00250	Forkhead	336 → 417	Forkhead domain	Domain

• Sequence:

  MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
  LNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQV
  HPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD
  STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQ
  SLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
  APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL
  NEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
  PSRCSNPTPGP

• Sequence length: 431

Pathways

KEGG:

Th17 cell differentiation
Inflammatory bowel disease

Reactome:

RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
RUNX1 regulates transcription of genes involved in WNT signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Centronuclear myopathy	Pathogenic	rs2519196832	RCV004587624	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FOXP3-related disorder	Likely pathogenic; Pathogenic	rs2519197052, rs2519185876, rs2519192078, rs1057520529, rs1557115532	RCV003402483 RCV003408398 RCV003982673 RCV003897856 RCV003392329	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hydrops fetalis	Pathogenic; Likely pathogenic	rs28935477, rs2066032846	RCV001290142 RCV001257372	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Pathogenic; Likely pathogenic	rs2147949202, rs2147944391, rs2147944159, rs2147947315, rs2147949090, rs2147949777, rs2147948858, rs2147944106, rs797045588, rs782528935, rs2519194123, rs2519194266, rs28935477, rs2147944039, rs122467169, rs122467170, rs1602679037, rs122467171, rs2147949186, rs122467172, rs122467174, rs122467175, rs886044787, rs2066083033, rs2519186384, rs1057520529, rs1557115532, rs1557116163, rs886041596, rs1569529565, rs1569529715, rs1557115786, rs1602684221, rs1602693008, rs2066088072, rs2066044949	RCV001420358 RCV002035836 RCV002022751 RCV001982984 RCV002029367 RCV001987185 RCV002012477 RCV002249996 RCV000194536 RCV000193687 RCV003143293 RCV003226056 RCV000012160 RCV000012161 RCV000012162 RCV000012163 RCV000012164 RCV000012166 RCV000012167 RCV000012168 RCV000012171 RCV000012172 RCV001380270 RCV003468224 RCV003461593 RCV003227748 RCV000504127 RCV001380271 RCV000697871 RCV000690380 RCV000701902 RCV000801492 RCV000825005 RCV000853242 RCV001035787 RCV001224826 RCV001204541	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multinucleated neurons-anhydramnios-renal dysplasia-cerebellar hypoplasia-hydranencephaly syndrome	Likely pathogenic	rs2147947553	RCV001375952	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic; Pathogenic	rs2066044949	RCV003389067	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-obstructive azoospermia	Pathogenic	rs1602684496	RCV000999511	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 1	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDRANENCEPHALY WITH RENAL APLASIA-DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR AZOOSPERMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	19394278, 23432692, 25468195		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	LHGDN	19108017		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	29419888		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23299803, 23566804, 25740578, 26931655, 31327269		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	19752775, 21113630		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27016413, 28892380		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	16252254		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18533240		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30405752		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31513797		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	31831860		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23529308, 26676638, 27687306, 28521455, 28935177		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19155524		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26724144		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26724144		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21547355		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18925695, 25425693, 26862953, 28789399, 29296965		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15198736, 15569983, 16361311, 16867905, 17278106, 18246047, 18510697, 19544530, 21347344, 24792037, 26550829, 26681759, 29600938, 30577817		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18246047		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	23962110		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	18681861, 20537411, 20843660, 29172719		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	37936298	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19178794, 19201288, 19679154, 21763379, 22487280, 22836044, 22992221, 24460842, 28102058, 28741671, 28802026, 28802126, 28894978, 30391960, 31030096, 31778687, 31807241		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	23196741, 28423200		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	23196741		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23143995, 28289705, 29574662		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	17463169	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	27702400, 36469034	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	19189134		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27901054, 29625390, 30474833		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29661773, 30359281, 31464648		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	25862984	Inhibit	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	29730433		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30894863	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27362416		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	20448211, 29524861		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	17463169, 27702400, 28195151, 29415633, 29710551, 31287345		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	LHGDN	17463169		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26187646, 26383248, 26615520, 26822994, 26830200, 29136784, 30290963, 30473441, 31327269, 31430072		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	35767890	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17911437, 18998771, 19066178, 20042455, 21607944, 23031059, 23541572, 25870037, 26561546, 27337150, 29543869, 29854762, 30537799, 31295689		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	23450683, 25092890, 26076982, 26561546	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	17469159, 23121667, 25092890, 26561546, 35410224, 37741520	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	36450783	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16537805, 21496382, 25164131, 28376277	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17392348, 19886735, 21926327, 22488116, 23280063, 24288552, 24452947, 24990235, 25042153, 27241313, 27421886, 27667787, 27834806, 28751821, 30954385, 30990587, 32111105, 32245307, 35764071	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26314565	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	19752528, 22515293, 26152611, 29148410		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	21483764		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15577848, 17349011, 18053016, 18475085, 19392991, 22515488, 22824748, 23346934, 23391720, 23786933, 24065069, 25048599, 25307458, 26409874, 27216911, 28672989, 28824424, 28944837, 28944907, 29225189, 29768397, 29874664, 30556232, 31030098, 31127789, 31722337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	16091206, 17393103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	17349011	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23573194	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	29317916, 36981683	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	17216339, 31846038		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26187646, 26383248, 26615520, 26822994, 26830200, 29136784, 30290963, 30473441, 31327269, 31430072		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26383248, 26822994, 27999237, 31430072	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27751813, 30590210		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27751813		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	18220288, 20884299, 22371007, 26812071, 30662663, 31422415		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12161590, 15096376, 15661028, 16126062, 16126962, 16216670, 16243487, 16393967, 16617117, 16682278, 16890893, 16920951, 17130555, 17196245, 17200412, 17418529, 17463169, 17534268, 17586580, 17917016, 17997492, 18264745, 18324481, 18854282, 18998771, 19020538, 19150256, 19394278, 19514119, 19836260, 19841877, 19875613, 19880293, 20015215, 20309000, 20382706, 20643476, 20937878, 21034673, 21036387, 21078762, 21115121, 21317396, 21346237, 21400500, 21496382, 21943781, 21979562, 22000667, 22392608, 22406048, 22450550, 22732485, 23228687, 23264341, 23313429, 23418628, 23432692, 23498308, 23582052, 23644754, 23853094, 23993983, 24012345, 24240290, 24337481, 24453252, 24610777, 24692218, 24768600, 24784317, 25083793, 25274247, 25326790, 25445496, 25468195, 25546394, 25708657, 25833964, 25911531, 25977253, 25982578, 26000316, 26190495, 26414764, 26441347, 26524592, 26735609, 26748735, 26751584, 26918796, 26975663, 27410049, 27466478, 27544816, 27687891, 27702400, 27882473, 27901054, 28052242, 28215223, 28216259, 28396406, 28508461, 28646041, 28652399, 28709804, 28747257, 28778586, 28813651, 28827353, 28833278, 28947964, 28988715, 29075264, 29270168, 29282318, 29307297, 29312905, 29366602, 29445371, 29455107, 29490770, 29575350, 29730990, 29845333, 30003817, 30027704, 30038387, 30107266, 30229436, 30254507, 30292536, 30368009, 30413714, 30482489, 30555473, 30620725, 30639036, 30664665, 30735648, 30771152, 30784578, 30918515, 31000202, 31101537, 31130368, 31140860, 31257581, 31322807, 31386175, 31468991, 31517385, 31607562, 31805313, 31808541		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17463169, 18599794, 19155519, 19299332, 19738030, 20190142, 20370571, 21828127, 22264504, 22294730, 22489829, 22736020, 22855503, 23223361, 23249428, 23432692, 24610777, 24784317, 25425428, 26063731, 26414764, 26441347, 26684629, 27211045, 27619682, 27702400, 27892628, 28298239, 28813651, 30027704, 30723474, 31808541, 32362325, 32646440, 32738192, 33274669, 33978826, 35479070, 35767890, 36717877, 37933083, 38201281	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22152480, 22392608, 29730990, 33746959	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28747257	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	18404362, 18978463		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	29686686, 34531853, 35479070, 36165514	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome type 1	Autoimmune polyendocrine syndrome type 1	Pubtator	28736829	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome, type 1	Autoimmune Polyendocrinopathy	BEFREE	16682278, 18404362		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	19375891, 25481456, 28440200		★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	25010330	Inhibit	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	31855573	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30936059		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29967615, 31831860		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	17508019		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25873156		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25873156, 32245315	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19800578		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	20299529	Inhibit	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	27659419		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	32878426, 36650632	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21443944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27189164, 27557492		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	27278091	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33974229	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	32513132	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	17355249	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22996231, 30802341		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34104541	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17570480, 17604714, 17653902, 18008005, 19264232, 19276356, 19787238, 20075077, 20306312, 21743493, 23319807, 23378296, 23688634, 23996727, 24338714, 24870556, 25712342, 26305693, 26475790, 26735887, 27118257, 27885422, 27913931, 28232080, 28388539, 28562349, 28621227, 28637482, 28756536, 29060923, 29187886, 29286921, 29405562, 29482642, 29549328, 29621426, 29947077, 29970908, 30011797, 30221739, 30825183, 30842152, 31440888, 31497220, 31819174		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17570480		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18294387, 18566447, 18685848, 18820666, 19604349, 20075077, 20229175, 20306312, 21649468, 22431701, 22471961, 23034170, 23169287, 23320561, 23502335, 24124553, 24338714, 24562936, 25193543, 26942414, 26979828, 27473163, 28029650, 28388539, 28562349, 28621227, 28713192, 28963773, 29241196, 29286921, 29405562, 29549328, 29615076, 29929548, 30011797, 30221739, 31852159, 32222891, 32580398, 32810665, 32939056, 33623115, 34365471, 34382943, 35120331, 35130925, 35614183, 36093688, 36437379, 36799186, 40108523	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22479588, 24338714, 34768829	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	30484986	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	BEFREE	17302902		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	23514217	Inhibit	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	17181632, 25401296, 28590036		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28033393	Associate	★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	22466646		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18510697, 36870289	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26823784	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17570480, 19577568, 21489891, 22467679, 23686119, 27466478, 31062086		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	19220831	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17508019, 27117439, 33623115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	21649468, 22471961, 23529839	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17372588	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18793383, 20346216, 21086571, 21251418, 23423978, 23526963, 23759077, 24761872, 25552913, 25907075, 26437631, 31006654, 31227589, 31903159, 33441885, 34092607, 34593621, 34605709, 36157928, 37056769, 37531206, 39838375	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18685848	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26249178, 32203210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34071045, 37573372	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27189164, 27557492		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16698419, 28253320, 28551657, 28731226, 29436663, 29666465, 30221050, 30452447, 31275431, 31571056, 31819529		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19641607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19673890	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24797069, 25669968, 26858311, 27329602, 31381571, 34758773, 36650632, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19188179, 19454729, 22143939, 25824786, 28939740, 32469992, 34081621, 36932108, 37940428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34795663	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19220831, 21200385, 22438899, 23572151, 35358193, 36550816	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16322292, 19628330		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	34876047	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	21422001	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	28207945, 34669781	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20448127, 21422001, 28207945		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27362416		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27499494, 35767890, 38213254	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33480285	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27241313	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	37175521	Associate	★☆☆☆☆ Found in Text Mining only
Cavitary Optic Disc Anomalies	Cavitary optic disc anomalies	Pubtator	29472922	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16216670, 16996248, 18435801, 19096978, 19120312, 20216098, 21832836, 27936497, 27995404, 28281276		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	19120312		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23874626, 28283419, 33717129, 37047806, 38415552	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	25465638	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	34895167	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19514119, 28013346, 28923073, 29229929, 29435163, 29790665, 30474571, 31177386		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	19514119, 29435163		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19514119, 28013346, 28923073, 29229929, 29435163, 29790665, 30474571, 31177386, 31191020		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	29473686	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22290731, 24291052		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22290731, 30377340, 34526987, 35597869, 36433731	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36455145	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	29051990	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	33213373	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19193737, 26794449		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29619880		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19452318		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21791252, 24720797, 28658564, 30629626, 31308239, 31440043		★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	31555698		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	19419438, 30413788		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28490401, 31326962		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26215124		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30213543		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	25139022	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	28947964, 29101067		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17056509, 20937878, 22753934, 22849659, 23643066, 23853094, 26813346, 27478940, 27874308, 28358365, 28623282, 28733028, 29056830, 29186109, 29441062, 30085016, 30250234, 31417552, 31730734		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	35563301	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18190460, 19292766, 22467146, 24282429, 25437819, 26333292, 27178149, 28453768, 31191543, 34160358, 34353876, 35905575	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26305224	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19513564, 19577568, 23773923, 24675384, 24938080, 25697896, 27372860, 27879345, 28591725, 29102042		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19577568, 22319577, 22879926, 30013992	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30013992		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17965063, 18825388, 18985040, 19856313, 21547355, 21884199, 22034888, 23382847, 23613769, 24291052, 24675384, 24827118, 25225903, 25268580, 25416053, 25608795, 25697896, 26439988, 26724144, 28560891, 29208565, 29209232, 29399395, 29848685, 30013992, 30621735, 30844974, 30952743, 31264122, 31364113, 31447586, 31624318, 31681276		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18985040, 20665489, 21179245, 21818290, 21904560, 22276195, 22408358, 23382847, 23963148, 24064667, 24675384, 24938080, 25225903, 25268580, 26339391, 26439988, 27196573, 27619682, 28560891, 30013992, 30658502, 31364113, 31429779, 31488881, 31921188, 32246094, 32390702, 32449240, 33045001, 35484226, 36285512, 36960042, 38041531, 38415552, 39207001	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30952743		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	31998307	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	17302902, 19162554, 19394278, 23432692, 25468195, 31103252, 31284281		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	17302902	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19162554, 23432692, 27188997, 32575504	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	21489307, 21762747, 23395622, 23759077, 24303990, 24626572, 31840342		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	27659419		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29476189		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21935395, 28565777		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	25214713, 28508461		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28939740, 29289594, 30930997, 31440091, 31494951		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23566804, 27997991, 28736945, 31430072		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23566804, 27997991, 28736945, 29051757, 29100058, 31430072		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33213373	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27997991	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23566804, 27997991, 28577936, 28736945, 31430072		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	36889300	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	16045746, 16126962, 18422560, 18512248, 20483763, 23974060, 24289115, 25500977, 26441347, 28088612, 28623282, 29489879, 30710380, 30710527, 30787928, 31077582		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16045746, 21147109, 22467146, 22736020, 24289115, 25071071, 26305224, 26441347, 28623282, 29453928, 29489879, 30710380, 35905575, 38211712, 38517030	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18422560	Inhibit	★☆☆☆☆ Found in Text Mining only
Crusting erythematous dermatitis	Crusting erythematous dermatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
CTLA4 deficiency	CTLA4 Deficiency	BEFREE	30107266		★☆☆☆☆ Found in Text Mining only
CTLA4 Haploinsufficiency	CTLA4 deficiency	BEFREE	25213377		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21489891		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	18931102	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29148410, 30168273		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17200412, 25911531		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22686584, 22968402, 29249119	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	25465638	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	17295794, 19189134, 20843660, 22187950, 22686584, 24499290, 29249119, 31637264		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18034969		★☆☆☆☆ Found in Text Mining only
Dermatitis, Occupational	Dermatitis	CTD_human_DG	29477354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	LHGDN	18681861		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	20488788		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	18681861, 20537411, 20843660, 29172719		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27039301	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	29172719	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17130555, 17534268, 18931102, 19841877, 21745722, 25481456, 29193502, 31781669		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17130555, 17534268, 18931102, 19841877, 21745722, 25481456, 29193502, 29567430, 31781669		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18931102, 21896932, 23409157, 25481456, 29193502, 29417186, 32894076, 34294806, 36600150, 36717877, 38408297	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Congenital Autoimmune	Diabetes mellitus	Pubtator	38408297	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Permanent Neonatal	Neonatal diabetes mellitus	Pubtator	18931102	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18248531, 19085184, 19141582, 19875613, 21368230, 24523574, 25481456, 25523632, 26224887, 26414764, 26473355, 26714416, 26888215, 27560779, 28053319, 29193502, 29757588, 29907148, 30723474, 31127857, 31808541, 34054801, 35058920, 35479070, 35626661, 35966054, 37164005	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18690669, 22332874, 28747257	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24677179, 31299986	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30270447, 36717877	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34079246	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12750858, 15220219, 16996248, 17327427, 17534268, 17709886, 18324481, 18435801, 18496979, 18973208, 19085184, 19096978, 19120312, 19132983, 19141582, 19956106, 21317396, 21368230, 21690251, 21832836, 21875694, 21943781, 22732485, 23490285, 24523574, 25481456, 25646305, 26414764, 26786322, 26975663, 27330188, 28947964, 29136677, 29757588, 30723474, 31127857, 31199784, 31322807, 31647813, 31808541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24167372, 28954308, 30270447, 30907193		★☆☆☆☆ Found in Text Mining only
DIABETES MELLITUS, PERMANENT NEONATAL	Diabetes Mellitus	BEFREE	18931102		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28983871, 29567430		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	29757588	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36717877	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21911743		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28623282, 33358585, 35479070	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	27892628		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18925695, 25425693, 26324762, 26862953, 26968188, 27045512, 28789399, 29296965		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	24292748	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	23607606	Associate	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	37970475	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22861363	Stimulate	★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	31170141	Associate	★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	32416752	Stimulate	★☆☆☆☆ Found in Text Mining only
Dystrophia unguium	Nail dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Echogenic Bowel	Echogenic Bowel	BEFREE	28317311		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24383466, 29206055, 30644698, 30875252		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	17295794, 19189134, 19471859, 20843660, 22187950, 22686584, 24499290, 26918796, 29249119, 31637264		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	22092655, 35479070	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28317311	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	11137992, 16901927, 21078762		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28114190, 29718856, 30401949, 31348233		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29718856, 30401949, 31348233, 39986022	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19841240, 21481380, 22341374, 24939730, 31042291		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21481380, 22341374, 25275597	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22541024	Stimulate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	28281276, 30364052		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	22267598	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24194940	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28529118		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20639775, 27921303, 28194801		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19628330		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	24291052		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21607687		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21607687		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36226375, 37340770, 40587482	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32884895, 36288460, 36522683	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22290731		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	32100077	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21619669	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	23514202, 29867995	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	25495686		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17038628		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34185421, 37828574	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31582185, 31625020		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18665940, 24121150, 28666843		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22228968, 31320834, 38366919	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	34755133	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29907148		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	20639775		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	26673565		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	27855396	Inhibit	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	31775513	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	34583923	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	15972593		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	34234776	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30821813		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16723631, 19028999, 24276989, 24570975, 24691423, 25555571, 29302887, 33429364, 35401877, 35757013	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23888189, 27862679, 29302887, 29900065		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23888189, 28880903, 29302887, 29900065		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17216339, 23108258, 23211717, 27862679, 29163521		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17216339, 23108258, 33429364	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	34876047, 35757013	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	18095005, 28469165, 29104670		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	24774748, 27225718	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35479070	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	28389590	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	15172973, 23792271	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	17478639, 19299332, 20302964, 22491736, 23818545, 24184334, 26473355, 28746369, 30027704, 36056390	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	15172973, 16038781, 16585024, 17161353, 19912254, 20424188, 23644754, 23818545, 23921175, 24184334, 24501220, 26693907, 28953925, 29126272, 30054205, 30242073, 30694220		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	15172973, 15972448, 17161353		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	20113371, 31164680	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	31164680		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16901927, 17644307, 20942809, 22219499, 24035934, 24784317, 25708657, 28222462, 28440200, 28569050, 28598035, 29259988, 29890310, 30391932, 30771152, 31055979, 31827051		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	20942809, 24478186, 24784317, 29259988, 37904681	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23249428, 27206624	Inhibit	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	25653477, 27349268	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32176314	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	17997492		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	19375891, 20942809, 24784317, 25481456, 28440200, 29230715, 29336238, 30771152, 31827051		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20942809, 22666793, 24478186, 24784317, 25412700, 27478306, 28690889, 29527211, 32606302	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	23249428, 27206624	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29473686	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21935395	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25984539	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	29850630	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27307158		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	19713458, 30842776		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	19713458		★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	26735609		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	26812071, 31422415	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21489307	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22489829, 23759077, 33506937, 36635631	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	21489307, 23759077	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25323532	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27243827	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	30233595	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	31781109	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30206415	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	30999581		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	20220088, 25031736		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18024321		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19096012, 20065852, 21904560, 23045593, 26722524, 32513132	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24942949	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	GENOMICS_ENGLAND_DG	26395338		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hydrops Fetalis	Hydrops fetalis	Pubtator	33637067, 35397126	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	24768948		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25433555, 29142309		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25894202	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	31141166	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29437833, 30074152		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	22017306		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	30425273	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	21782277, 27063510		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	18931102	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	23624130, 29896255		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	27478306	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24931519	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31287590, 34478955, 36157928	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Lamellar	Lamellar ichthyosis	Pubtator	28317311	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	31555701		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	20537411		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28648519		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20126467, 20646340	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34872285	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29494956		★☆☆☆☆ Found in Text Mining only
Ileus	Ileus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome	Immune Dysregulation-Polyendocrinopathy-Enteropathy-X-Linked Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	11685453, 16596204, 18489537, 19641188, 19679154, 20309000, 24316592, 30125971, 31653719, 31681337		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	18931102, 30229436, 32988630, 34446704, 35967314	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	17067661, 20100010, 25305033, 28300523, 29200102		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16890893, 20309000, 22214236, 22674548, 24268809, 24453252, 30229436		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	20537411		★☆☆☆☆ Found in Text Mining only
Industrial Dermatosis	Industrial Dermatosis	CTD_human_DG	29477354		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	21481380, 22341374, 36603467	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31855573	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16045746, 16126962, 19936899, 20483763, 20937878, 23773923, 23853094, 24792626, 25479423, 28088612, 28337881, 28667749, 28677759, 28733028, 28822915, 28983404, 29156761, 30584414, 30600673, 31664129, 31678865, 31715619, 31784682		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16045746, 18330941, 21376048, 22736020, 24792626, 26305224, 31664129, 32084423, 35905575	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	27236803, 31145753		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17200412		★☆☆☆☆ Found in Text Mining only
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	UNIPROT_DG	11120765, 11137992, 11137993, 11768393, 18951619, 21458306		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	BEFREE	11137992, 11137993, 11685453, 12092451, 14671208, 16126062, 16371377, 16617117, 16630773, 16741580, 16781310, 16920951, 17378693, 17484868, 17586580, 18316354, 18795917, 18931102, 18951619, 19189134, 19410687, 19471859, 19641188, 20643476, 20842625, 21262102, 21400500, 21802372, 21865090, 21997382, 22264504, 23313429, 23534934, 24075450, 24337481, 25274247, 25326164, 26395338, 26748374, 26748735, 26918796, 28317311, 28833278, 28887914, 29150659, 29193502, 29312905, 29400909, 29704593, 29705245, 29907148, 30443250, 30639036, 30709738, 31322807		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	CLINVAR_DG	11137992, 11137993, 28778586, 28783662		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	GENOMICS_ENGLAND_DG	11137992, 11295725, 14671208, 17635943, 26395338, 27302973, 28425981		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	ORPHANET_DG	11137993		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	CTD_human_DG	27783946		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Interleukin 2 Receptor, Alpha, Deficiency of	Interleukin 2 Receptor Deficiency	BEFREE	17196245		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	12296863, 14997560, 15661028, 17916446, 18489537, 22264504, 25326164, 28457527, 28833278, 29193502, 29312905, 29704593		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22228968	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21547355		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	21091665	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24291052		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20306312, 28430349, 28592128, 31497220		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17244166, 27272011		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	30586716		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29353353		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15128835, 17526924, 18628282, 23121667, 25092890, 26561546, 30333832		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	17526924		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	30206415, 31809310		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21494640, 28643491	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	40751815	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19193737, 26794449		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	28954788		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36751634	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	18681861		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23835793, 28949956, 29257349		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	21864931		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	27357431	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	36786033	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	25139022	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	25200768	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	24214631		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24214631, 25672298, 29883464, 34748560	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	24214631, 24454972	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17161353, 17920118, 22705645		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18510697, 18569641, 30468481, 31758697, 36706355	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20801903	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23179394, 27016413, 29843224, 32802845, 33083479, 37928542	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17164341, 19283381, 23179394, 27016413, 28892380, 30510164		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16361311, 16867905, 18510697, 19544530, 21347344, 24792037, 26681759, 29600938		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	28935177, 31773516		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	30883858		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28174027		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17928188, 19093253, 19329856, 22419479, 23599540, 23759077, 24303990, 24668348, 24827118, 25000974, 25552913, 25907075, 26437631, 26641260, 28529568, 28903735, 29387180, 29928435, 30904437, 30930991, 31006654, 31316604, 31616517, 31769216, 31819529		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25323532, 26215124		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25323532	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28355233, 30233595	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17158635, 28146070, 33675743	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	19302244	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30030493		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36635631	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	29229400	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30378283		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30378283, 31653148	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24292748, 29472922, 33589523	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	24292748	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28508461		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16596204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	22884069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	27692344, 28253320, 29436663, 33589523	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	28187172	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18681861, 19458162, 22406048, 30170030, 31329981, 31468991		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	17530636	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16423064, 18311820, 18668553, 19155519, 19173720, 21708033, 22506043, 23125486, 25986394, 27156107, 27225718, 28542701, 29023682, 30009168, 31781109, 33329581, 33686190, 33746959, 34240405, 34940981, 35767890, 36107445, 36314527, 37782178	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17277168, 18052965, 18505426, 21496382, 24288552, 26079624, 32718891	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18800986, 23925905, 24774748, 28747257, 32317002	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19458162, 22406048, 30170030, 31329981, 31468991		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16216670, 16423064, 16735466, 18052965, 18404362, 18413409, 19173720, 19185065, 19458162, 20618924, 21078762, 21496382, 22120729, 22406048, 22942433, 23264341, 24221578, 25083793, 25862984, 28254841, 28542701, 30079446, 30154885, 30170030, 30568041, 30894863, 31130368, 31329981, 31468991		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17712998		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19458162, 20850528, 24475019, 24482023, 25339666, 26673565, 30359968		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24475019, 24774748, 25339666, 27156107, 37368057	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19458162, 22406048, 30170030, 31329981, 31468991		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19604349, 21930068, 22569001, 23760912, 24040244, 26464616, 27457382, 28084319, 28923073, 31852159, 31930120, 32615729, 33062072, 40587482	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28560891	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28923073		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36285512	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17615291	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18246047		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18246047, 26464657, 26968188	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18681861, 20668237, 26968188		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21904560	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	31640798	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	16825494		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	21898141		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17615291		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21898141, 23682557		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21898141		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16557241, 16741512, 18569641, 19626037		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	31640798		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	16038781, 17484867, 18193342		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11138001		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	19365016		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30802341		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17570480, 17604714, 18008005, 19264232, 19276356, 19787238, 20075077, 20306312, 21326202, 21743493, 23319807, 23378296, 23688634, 23996727, 24338714, 24870556, 25712342, 26305693, 26475790, 26735887, 27118257, 27885422, 27913931, 28232080, 28254786, 28388539, 28562349, 28621227, 28637482, 28756536, 29060923, 29187886, 29286921, 29405562, 29482642, 29549328, 29621426, 29947077, 29970908, 30011797, 30221739, 30825183, 31440888, 31497220, 31819174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17570480		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29718856, 31348233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21607687, 23760912, 31082908		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24827118, 29700411		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25552913, 31653148		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16698419, 28253320, 28551657, 28731226, 29436663, 29666465, 30452447, 31275431, 31571056, 31819529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28174027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16322292, 19628330, 20006900		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21113630, 31570431		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18056169, 19800578, 20678582, 21034673, 21278236, 22034888, 23319807, 25712341, 30057362, 30500076, 30733194, 30999388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21528082, 22569001, 23178569, 23201402, 24040244, 24331841, 24548868, 24657498, 24827118, 25385008, 28412752, 28743116, 29696715, 29804142, 29848687, 29872566, 31850212		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30005868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27189164, 27557492		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17570480, 17804750, 17928188, 18324481, 19513564, 19900843, 20096010, 20498631, 20518821, 21034673, 21278236, 21489891, 21547355, 21719142, 21837700, 21997230, 23313429, 23319807, 23382847, 23688634, 23695722, 23756166, 23760912, 23773923, 24155921, 24548868, 25268580, 25712342, 25779374, 26686090, 27189164, 27362416, 27892628, 28174027, 28215223, 28253320, 28396406, 28591725, 28646041, 28652399, 28716029, 28903735, 29075318, 29163797, 29549328, 29620159, 29900065, 30011797, 30040923, 30142808, 30341017, 30416665, 30527194, 30782783, 30819277, 31275431, 31316604, 31681337, 31831860		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	20110382		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19514119, 28013346, 28923073, 29229929, 29435163, 29790665, 30474571, 31177386		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19513564, 19577568, 23773923, 24675384, 24938080, 27372860, 27879345, 28591725, 29102042		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17570480		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17570480, 18008005, 18294387		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17570480		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19264232, 21326202, 25712342, 26735887, 28756536, 29262592, 30524905		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17570480		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17574040, 20924102, 21098714, 21357539, 21410773, 21489891, 21547596, 23045606, 24406338, 27868139, 28728868, 29307625, 29620159, 29898988, 31287590		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17574040, 17851585, 18413770		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17574040	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18414854, 18820132, 21547596, 23284620, 29620159, 31630873, 33117345, 34051744, 34112666, 35909944, 37197667	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31630873, 34051744	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25400783	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22467679, 31808008		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19309551	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30405296	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	21410773, 28412591, 31287590		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	19380797, 23432877, 25546394, 26345847		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	31841221		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	25938517		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	16410445, 25409753		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18330941, 25275597	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20412712, 20718783		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20718783, 25039241, 37506144	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	22955109	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	21812857, 30999581		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16150935, 16410445, 21904560, 22666318, 23152910, 23232072, 25099367	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16410445, 18071334, 23152910, 25099367, 25409753		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15952173, 17011048, 18771523, 18836525, 19237575, 19758707, 20561040, 20847001, 21891821, 23039885, 24098530, 25326790, 25938517, 26414764, 27154631, 27370539, 28038358, 28320131, 28363955, 29589548, 30229436, 30572285, 31414141, 31567981		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15952173		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	17944900, 18771523, 23039885, 24098530, 25938517, 26414764, 26714422, 27154631, 27424664, 29487369, 29527211, 30122421, 30229436, 30759186, 32988630, 33170805, 33329593, 34006899	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19016907, 21731726, 29295981	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	16583400, 30219744		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	22496194	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	19111574, 22000402, 23110942, 23228687, 24768600, 26875774, 28599652, 29655674		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	23110942, 26347149, 26460311	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	19674197	Inhibit	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	24171863, 24610622, 26225678, 35642346	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19020538, 23029178, 28113084		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25371165		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22426168	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28417620		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	21422001, 25144227, 35265721	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30035131		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	20537411		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	24594700	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21414848	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	18793874, 19250527, 19639723, 22462754, 22959364, 30002685		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19250527, 38072196	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19639723	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17262084, 19220831, 28871094, 31138162, 32564263, 32573058	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28871094, 28877959, 31138162		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	27488085		★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	17635943, 18931102		★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15328188, 16596204, 17216339, 17604714, 17804750, 17928188, 17932340, 18008005, 18413770, 18569641, 18985040, 19264232, 19276356, 19329856, 19513564, 19538059, 19539651, 19544530, 19577568, 19626037, 19800578, 19856313, 19900843, 19915919, 20006900, 20012605, 20075077, 20197202, 20434787, 20678582, 21034673, 21098714, 21278236, 21327637, 21359545, 21410773, 21489891, 21547596, 21611754, 21719142, 21743493, 21812857, 21837700, 21884199, 21935436, 21945823, 22123319, 22123924, 22152480, 22186896, 22193988, 22303460, 22467679, 22569001, 22674548, 22743317, 22884069, 22996231, 23045606, 23178569, 23211717, 23213058, 23280127, 23313429, 23319807, 23378296, 23382847, 23529308, 23529839, 23599540, 23613769, 23682557, 23688634, 23760912, 23888189, 24155921, 24291052, 24303990, 24308961, 24331841, 24338714, 24406338, 24416401, 24517146, 24548868, 24675384, 24742251, 24827118, 24870556, 24877082, 25223704, 25225903, 25284464, 25395319, 25446402, 25548231, 25582080, 25697896, 25712342, 26249178, 26423152, 26496037, 26541534, 26641260, 26686090, 26724144, 26735887, 27045886, 27118257, 27189164, 27463005, 27557492, 27574108, 27862679, 27879269, 27916317, 28013346, 28084319, 28174027, 28176947, 28177891, 28253320, 28344860, 28351575, 28412591, 28430349, 28472762, 28481241, 28487507, 28490401, 28521455, 28541302, 28560891, 28591725, 28614908, 28627635, 28716029, 28776578, 28789399, 28814673, 28818640, 28819402, 28839202, 28868572, 28877959, 28885584, 28903735, 28932643, 28970798, 29043413, 29124314, 29187886, 29209232, 29236775, 29237087, 29288043, 29307625, 29308306, 29312633, 29337110, 29387180, 29436663, 29482642, 29492202, 29620159, 29696715, 29715119, 29843813, 29863904, 29872566, 29875321, 29970908, 30011797, 30040923, 30054205, 30057362, 30061879, 30077124, 30095632, 30221050, 30221739, 30240146, 30297881, 30401949, 30416665, 30458852, 30502715, 30524879, 30616523, 30630091, 30655866, 30670774, 30687269, 30756505, 30781400, 30798159, 30800128, 30825183, 30885276, 30907146, 30930997, 30994705, 30999388, 31006654, 31026471, 31062086, 31118034, 31134811, 31138426, 31166985, 31285612, 31391067, 31440091, 31497220, 31501892, 31546872, 31582185, 31609157, 31616592, 31628200, 31631566, 31640798, 31649669, 31653980, 31729760, 31815635, 31817155, 31841221, 31846038		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	26191151, 31468991		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	25911531		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	25911531		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	18931102	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30062391	Inhibit	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	19189134		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	26329520, 27016413	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26161395	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30771576		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	19344427	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28871094		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16596204, 19538059, 21611754, 21719142, 22608141, 22884069, 24035934, 25338928, 26541534, 27000869, 27463005, 27574108, 28187172, 28551657, 28716029, 29959381, 30297881, 30341017, 30907146, 30953385, 31134811, 31275431, 31843013		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17653902, 26249178		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22228716, 38213254	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31136754		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34382943	Stimulate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	21818290	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23280127		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	31846038		★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	19084106, 19767069, 20109747		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	23686119	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27044824	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30168273		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	32954739	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	20483756, 20920469		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20197202		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16322292, 19628330		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16322292		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19673890, 36837407	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23354626, 24244610, 26166762, 31537619, 34181334, 34502561, 35186171	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17804750, 21113630, 31570431		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17804750		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18430198, 23363422, 25669968, 26191284, 27589570, 33062072	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34933280	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24797069	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	21113630		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27362416		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24517146, 26264613, 29230715, 30443770		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	22322668		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	22322668, 35322929	Associate	★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	25204704	Associate	★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	33178221	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15864345, 18326816, 20945034	Inhibit	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	19740339, 22647666, 24845974, 31340370	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	24041428, 29600938	Stimulate	★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	Pubtator	26225678	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29621426	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	40280259	Inhibit	★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	19350181	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	22310732	Inhibit	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	36349750	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	28216259		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	25401296		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	25557886	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	22228968	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	28666843, 29938865		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	28565777		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	17355249	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29633265		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15972593, 28392902, 29633265		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18173798		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30944162, 37277792	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	36091011	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	33269456	Associate	★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	29626602		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19122524, 25862984		★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	16682278, 18842982, 20805020, 26903483		★☆☆☆☆ Found in Text Mining only
Polyglandular Type III Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	25481456		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29172719		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	29172719	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26686090, 27574108		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	27362416		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16126962, 17158635, 17518371, 19302244, 25701076, 28146070		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28508176		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31640798		★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	21036387		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17518371, 24412607		★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	29193502, 35130925	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18056169, 19800578, 23319807, 25712341, 30057362, 30500076, 30733194, 30999388		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	19800578		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19800578, 21034673, 25712341		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18056169, 19800578, 21357539		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28547958, 28961847, 31549213, 35983819	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	24774748, 35479070	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19626037, 19752528, 19880293, 20843660, 23418628, 27555499, 28027921, 28444425, 29358932, 29686529		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28042206	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	19752528, 24316592, 28738533		★☆☆☆☆ Found in Text Mining only
PTEN Hamartoma Tumor Syndrome	PTEN Hamartoma Tumor Syndrome	BEFREE	27477328		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18684844, 23514217, 24805101, 31141166, 34079246, 35780120	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21651772, 22032685, 27310557, 30842769, 31308239, 31440043, 33317530, 34206428, 35687771	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	25010330	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21791252		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21072213		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30655866		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	26154600		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	19847432, 22447883, 22515293, 28750075, 29411043		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29289594, 30930997, 31440091, 31494951		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19424039, 28693431		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16216670, 17392348, 18037337, 18092263, 19847432, 20476861, 21346237, 21496382, 22447883, 22515293, 23031059, 23264341, 25042153, 25164131, 25448791, 25604080, 26062995, 26314565, 26751840, 27834806, 27875659, 27909722, 28478516, 28750075, 29381842, 29411043, 29730433, 29851536, 30045854, 30168273, 30292536, 30537799, 30954385, 30990587, 31074719, 31130368, 31609517		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20476861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	Pubtator	23573194	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	21091665, 22201619, 24460842	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	18820666	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	22515293, 26152611		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	18279440, 18496979, 30452447		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18279440, 24882950	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	38173720	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28819402		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	32109548	Inhibit	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	31770615		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20591136		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35720398	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22172643, 29182416, 31182172		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	18193342, 26856578		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	32265901	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18569641, 18769452, 19626037		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	19626037, 19901946, 26225678, 32409671	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	23613769	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29600938, 30632148	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33228011	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	24335103, 34748560	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	24454972	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	28562338		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	18496979, 20843660, 22556091, 27811935, 28849568		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	17970785	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	22077067, 32210181	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32380702	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	28947964, 29101067		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20197202, 22077067		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30077124		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34006632	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	16652285		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	27188997	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16180249, 27901054	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17975141, 19108017		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18794336, 20110382, 20463594, 21837700, 28403126, 30994705		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18547033, 23977174, 24761979, 25779374, 27457382, 27841362, 30994705, 32304268, 32383556, 33010009, 33307825, 34319010, 34626165, 35664436, 36097539, 37210507, 38376584, 39695576	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	30994705		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28351575, 28932643, 28975663, 29506555, 30364350, 30781400, 30997315		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30040923		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	21524750		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	31555701		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21528082, 22569001, 23178569, 23201402, 24040244, 24548868, 24657498, 24827118, 25385008, 28412752, 28743116, 29696715, 29804142, 29848687, 29872566, 31631566, 31850212		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	29025424	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21528082, 22228968, 22569001, 23723999, 24040244, 24460353, 26823784, 28743116, 29089565, 29391307, 30936882, 30988066, 31174544, 31631566, 31930120, 33575321, 33906525, 33978826, 34414959, 34968167, 35037550, 35443723, 37970473	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	20699236, 23264341, 23707908, 23776439, 27902985, 28522286, 29030005, 29854846, 31840939		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29898383		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30021560		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	21251418, 23759077	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	30429036		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	17590173, 22000402, 24768600, 26875774		★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	22000402		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25653477, 28222462		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26264613, 32606302, 36518249, 37563607	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30005868		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	17418529		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20942809, 24784317, 30443770		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	23249428	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30005868		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22666793, 27045886, 27892628, 30005868, 36203616	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	24478186	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	29230715		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	19141582, 20942809, 24478186, 24784317, 25481456, 36518249	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	23249428, 27206624	Inhibit	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26709833	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11753102, 17917016		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24877082, 25395319, 29455927, 31096176		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24877082, 28713192, 28984302, 32622323, 32681436, 34362334, 38308298, 39986022	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	26496037, 39207001	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	26496037		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	19150256		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	19150256, 26709833	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16216670, 20544711, 21711349, 23974060, 25437819, 26333292, 26730791, 27178149, 28088612, 28881831, 29464806, 30425718, 30918515, 31077582, 31191543, 31630153		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18240282		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26862849, 26927070, 35227680, 35314433, 36870289	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34539008	Stimulate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	18440785		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19079205, 19089920	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22986453, 34739585, 36792811	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17433037, 19808652, 21930068, 22986453, 23760912, 26464616, 28923073, 29229929, 30474571, 31177386, 33880574, 34674573, 35322929, 38084896, 39346086	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23587428	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	20209608, 33203661, 36466923	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22743317		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	19365016, 25716996		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	25873156		★☆☆☆☆ Found in Text Mining only
Variegate Porphyria	Variegate Porphyria	BEFREE	30382756		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	38213254	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34950150	Inhibit	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	20110382	Associate	★☆☆☆☆ Found in Text Mining only
Vipoma	Vipoma	Pubtator	33358585	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	26507129		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	25510482	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	20175879, 25479423	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	23498308, 23582052, 25479423, 28247923, 29199612		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33200798, 40723924	Inhibit	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	23498308, 23582052, 25479423, 28247923, 29199612		★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar lichen sclerosus	Pubtator	33438816	Inhibit	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	31846038		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	11753102, 19084106, 21997382, 24461257		★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	31640798		★☆☆☆☆ Found in Text Mining only