PCBP1 (poly(rC) binding protein 1)

Gene

• Entrez ID: 5093
• Gene name: Poly(rC) binding protein 1
• Gene symbol: PCBP1
• Synonyms (NCBI Gene): HEL-S-85, HNRPE1, HNRPX, hnRNP-E1, hnRNP-X
• Chromosome: 2
• Chromosome location: 2p13.3
• Summary: This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004814	hsa-miR-21-5p	Quantitative proteomic approach	19253296
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT048509	hsa-miR-100-5p	CLASH	23622248
MIRT038098	hsa-miR-423-5p	CLASH	23622248
MIRT036126	hsa-miR-1296-5p	CLASH	23622248
MIRT035937	hsa-miR-1180-3p	CLASH	23622248
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23446348
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT492808	hsa-miR-4321	PAR-CLIP	23446348
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT089339	hsa-miR-10a-3p	PAR-CLIP	23592263
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT492808	hsa-miR-4321	PAR-CLIP	23592263
MIRT236806	hsa-miR-3936	PAR-CLIP	23592263
MIRT353816	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT236807	hsa-miR-4773	PAR-CLIP	23592263
MIRT353812	hsa-miR-2681-3p	PAR-CLIP	23592263
MIRT303380	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT471529	hsa-miR-4461	PAR-CLIP	23592263
MIRT236805	hsa-miR-922	PAR-CLIP	23592263
MIRT236808	hsa-miR-5681a	PAR-CLIP	23592263
MIRT303381	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT471528	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT471527	hsa-miR-8085	PAR-CLIP	23592263
MIRT471526	hsa-miR-3941	PAR-CLIP	23592263
MIRT353814	hsa-miR-4672	PAR-CLIP	23592263
MIRT471525	hsa-miR-466	PAR-CLIP	23592263
MIRT303378	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT303377	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT303379	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT004814	hsa-miR-21-5p	Microarray	32170623
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23446348
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT492808	hsa-miR-4321	PAR-CLIP	23446348
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT089339	hsa-miR-10a-3p	PAR-CLIP	23592263
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT492808	hsa-miR-4321	PAR-CLIP	23592263
MIRT236806	hsa-miR-3936	PAR-CLIP	23592263
MIRT353816	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT236807	hsa-miR-4773	PAR-CLIP	23592263
MIRT353812	hsa-miR-2681-3p	PAR-CLIP	23592263
MIRT303380	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT471529	hsa-miR-4461	PAR-CLIP	23592263
MIRT236805	hsa-miR-922	PAR-CLIP	23592263
MIRT236808	hsa-miR-5681a	PAR-CLIP	23592263
MIRT303381	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT471528	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT471527	hsa-miR-8085	PAR-CLIP	23592263
MIRT471526	hsa-miR-3941	PAR-CLIP	23592263
MIRT353814	hsa-miR-4672	PAR-CLIP	23592263
MIRT471525	hsa-miR-466	PAR-CLIP	23592263
MIRT303378	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT303377	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT303379	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216375	hsa-miR-1305	CLIP-seq
MIRT1216376	hsa-miR-1323	CLIP-seq
MIRT1216377	hsa-miR-1468	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216380	hsa-miR-3120-3p	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216383	hsa-miR-3143	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216385	hsa-miR-323-3p	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216389	hsa-miR-3613-3p	CLIP-seq
MIRT1216390	hsa-miR-3617	CLIP-seq
MIRT1216391	hsa-miR-3671	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216394	hsa-miR-4282	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216396	hsa-miR-433	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216399	hsa-miR-4436b-5p	CLIP-seq
MIRT1216400	hsa-miR-4477a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216402	hsa-miR-4517	CLIP-seq
MIRT1216403	hsa-miR-4668-5p	CLIP-seq
MIRT1216404	hsa-miR-4760-3p	CLIP-seq
MIRT1216405	hsa-miR-489	CLIP-seq
MIRT1216406	hsa-miR-526b	CLIP-seq
MIRT1216407	hsa-miR-543	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216410	hsa-miR-548ac	CLIP-seq
MIRT1216411	hsa-miR-548ae	CLIP-seq
MIRT1216412	hsa-miR-548aj	CLIP-seq
MIRT1216413	hsa-miR-548am	CLIP-seq
MIRT1216414	hsa-miR-548d-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216417	hsa-miR-548g	CLIP-seq
MIRT1216418	hsa-miR-548o	CLIP-seq
MIRT1216419	hsa-miR-548x	CLIP-seq
MIRT1216420	hsa-miR-548z	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216424	hsa-miR-607	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT1216426	hsa-miR-641	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216377	hsa-miR-1468	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216399	hsa-miR-4436b-5p	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216405	hsa-miR-489	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216406	hsa-miR-526b	CLIP-seq
MIRT1216407	hsa-miR-543	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216403	hsa-miR-4668-5p	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216410	hsa-miR-548ac	CLIP-seq
MIRT1216411	hsa-miR-548ae	CLIP-seq
MIRT1216412	hsa-miR-548aj	CLIP-seq
MIRT1216413	hsa-miR-548am	CLIP-seq
MIRT1216414	hsa-miR-548d-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216419	hsa-miR-548x	CLIP-seq
MIRT1216420	hsa-miR-548z	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216385	hsa-miR-323-3p	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216400	hsa-miR-4477a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216417	hsa-miR-548g	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	8152927
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	7556077, 7607214, 8152927
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	14722620
GO:0005515	Function	Protein binding	IPI	16713569, 17389360, 20374249, 21994455, 22028648, 22365833, 22673507, 25416956, 28169274, 31515488, 32296183, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0039694	Process	Viral RNA genome replication	IDA	12414943
GO:0039694	Process	Viral RNA genome replication	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0098847	Function	Sequence-specific single stranded DNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 601209
• HGNC: 8647
• e!Ensembl: ENSG00000169564

Protein

• UniProt ID: Q15365
• Protein name: Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3)
• Protein function: Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed:15731341, PubMed:7556077, PubMed:7607214, PubMed:8152927). Together with PCBP2, required for erythropoiesis, possibly by regulating mRNA splicing (By simi
• PDB: 1WVN, 1ZTG, 3VKE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00013	KH_1	15 → 77	KH domain	Domain
  PF00013	KH_1	99 → 164	KH domain	Domain
  PF00013	KH_1	281 → 345	KH domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands. {ECO:0000269|PubMed:760
• Sequence:

  MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
  LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
  KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
  IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
  VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
  NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS

• Sequence length: 356

Pathways

KEGG:

Spliceosome
Ferroptosis
Cytosolic DNA-sensing pathway

Reactome:

mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24577199		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	38013317	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	15514164	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27102006		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31223278	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37927213	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	26173642		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21654215	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35907982	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30086790		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20361869	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34857818	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27683057		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	15514164		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	15514164	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15514164	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15514164		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	15514164	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28076324		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28076324	Associate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	26802051	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	38013317	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35287546	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35287546	Associate	★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	21930702	Associate	★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	21930702, 22351779, 28250194		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24889597		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	22801034	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30984540	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31599037		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	22801034	Associate	★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	28375153		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26293996	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20926737		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24819169	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35907982	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27102006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24889597		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27683057		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28560430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25661993, 27629145, 30078000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25612617, 29138420		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28337299		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21654215, 27629145, 27746021, 29396052, 30086790		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12431987		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29958803		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28381556		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22260379	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25265318, 27629145, 28337299, 28825698, 29622466, 30078000, 30086790, 30132844, 30692635		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28077174		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25265318	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28560430		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28077174		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29138420	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35909514	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25661993, 27629145, 30078000		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25661993, 27629145	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30078000		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27812736		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	28077174		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31223278		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31223278	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27629145		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25612617, 29138420		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29138420	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35100974, 37303491	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28337299		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28337299		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28963376	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12890803	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12890803, 35896897	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31223288	Associate	★☆☆☆☆ Found in Text Mining only