Gene Gene information from NCBI Gene database.
Entrez ID 5093
Gene name Poly(rC) binding protein 1
Gene symbol PCBP1
Synonyms (NCBI Gene)
HEL-S-85HNRPE1HNRPXhnRNP-E1hnRNP-X
Chromosome 2
Chromosome location 2p13.3
Summary This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The p
miRNA miRNA information provided by mirtarbase database.
312
miRTarBase ID miRNA Experiments Reference
MIRT004814 hsa-miR-21-5p Quantitative proteomic approach 19253296
MIRT004814 hsa-miR-21-5p Luciferase reporter assay 22316494
MIRT004814 hsa-miR-21-5p Luciferase reporter assay 22316494
MIRT004814 hsa-miR-21-5p Luciferase reporter assay 22316494
MIRT004814 hsa-miR-21-5p Luciferase reporter assay 22316494
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IBA
GO:0003697 Function Single-stranded DNA binding IDA 8152927
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601209 8647 ENSG00000169564
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15365
Protein name Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3)
Protein function Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed:15731341, PubMed:7556077, PubMed:7607214, PubMed:8152927). Together with PCBP2, required for erythropoiesis, possibly by regulating mRNA splicing (By simi
PDB 1WVN , 1ZTG , 3VKE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 15 77 KH domain Domain
PF00013 KH_1 99 164 KH domain Domain
PF00013 KH_1 281 345 KH domain Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands. {ECO:0000269|PubMed:760
Sequence
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIID
KLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICL
VMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINA
RLSSEKGMGCS
Sequence length 356
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome
Ferroptosis
Cytosolic DNA-sensing pathway
  mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 24577199
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Pubtator 38013317 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic valve stenosis Pubtator 15514164 Stimulate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 27102006
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 31223278 Inhibit
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Breast neoplasm Pubtator 37927213 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma Burkitt`s Lymphoma BEFREE 26173642
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 21654215 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 35907982 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 30086790
★☆☆☆☆
Found in Text Mining only