NTM (neurotrimin)

Gene

• Entrez ID: 50863
• Gene name: Neurotrimin
• Gene symbol: NTM
• Synonyms (NCBI Gene): CEPU-1, HNT, IGLON2, NTRI
• Chromosome: 11
• Chromosome location: 11q25
• Summary: This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006824	hsa-miR-182-5p	Luciferase reporter assay, Western blot	22917588
MIRT006824	hsa-miR-182-5p	Luciferase reporter assay, Western blot	22917588
MIRT645476	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT645475	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT645474	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT645473	hsa-miR-340-5p	HITS-CLIP	23824327
MIRT645476	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT645475	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT645474	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT645473	hsa-miR-340-5p	HITS-CLIP	23824327
MIRT1196059	hsa-miR-1207-3p	CLIP-seq
MIRT1196060	hsa-miR-1825	CLIP-seq
MIRT1196061	hsa-miR-199a-5p	CLIP-seq
MIRT1196062	hsa-miR-199b-5p	CLIP-seq
MIRT1196063	hsa-miR-3159	CLIP-seq
MIRT1196064	hsa-miR-3545-5p	CLIP-seq
MIRT1196065	hsa-miR-369-3p	CLIP-seq
MIRT1196066	hsa-miR-374a	CLIP-seq
MIRT1196067	hsa-miR-374b	CLIP-seq
MIRT1196068	hsa-miR-3925-3p	CLIP-seq
MIRT1196069	hsa-miR-513b	CLIP-seq
MIRT1196070	hsa-miR-568	CLIP-seq
MIRT1196071	hsa-miR-766	CLIP-seq
MIRT1196072	hsa-miR-1225-3p	CLIP-seq
MIRT1196073	hsa-miR-1233	CLIP-seq
MIRT1196074	hsa-miR-129-3p	CLIP-seq
MIRT1196075	hsa-miR-3929	CLIP-seq
MIRT1196076	hsa-miR-4265	CLIP-seq
MIRT1196077	hsa-miR-4296	CLIP-seq
MIRT1196078	hsa-miR-4322	CLIP-seq
MIRT1196079	hsa-miR-4417	CLIP-seq
MIRT1196080	hsa-miR-4419b	CLIP-seq
MIRT1196081	hsa-miR-4478	CLIP-seq
MIRT1196082	hsa-miR-4663	CLIP-seq
MIRT1196083	hsa-miR-485-5p	CLIP-seq
MIRT1551898	hsa-miR-4434	CLIP-seq
MIRT1551899	hsa-miR-4436b-3p	CLIP-seq
MIRT1551900	hsa-miR-4516	CLIP-seq
MIRT1551901	hsa-miR-4531	CLIP-seq
MIRT1551902	hsa-miR-614	CLIP-seq
MIRT1556743	hsa-miR-4532	CLIP-seq
MIRT1196060	hsa-miR-1825	CLIP-seq
MIRT1196061	hsa-miR-199a-5p	CLIP-seq
MIRT1196062	hsa-miR-199b-5p	CLIP-seq
MIRT2056885	hsa-miR-323-5p	CLIP-seq
MIRT1196064	hsa-miR-3545-5p	CLIP-seq
MIRT1196068	hsa-miR-3925-3p	CLIP-seq
MIRT2056886	hsa-miR-4467	CLIP-seq
MIRT1556743	hsa-miR-4532	CLIP-seq
MIRT1196071	hsa-miR-766	CLIP-seq
MIRT2056887	hsa-miR-876-3p	CLIP-seq
MIRT2583424	hsa-miR-1301	CLIP-seq
MIRT1196060	hsa-miR-1825	CLIP-seq
MIRT1196061	hsa-miR-199a-5p	CLIP-seq
MIRT1196062	hsa-miR-199b-5p	CLIP-seq
MIRT2583425	hsa-miR-2116	CLIP-seq
MIRT2583426	hsa-miR-3122	CLIP-seq
MIRT2583427	hsa-miR-3153	CLIP-seq
MIRT1196063	hsa-miR-3159	CLIP-seq
MIRT2583428	hsa-miR-3163	CLIP-seq
MIRT1196064	hsa-miR-3545-5p	CLIP-seq
MIRT1196065	hsa-miR-369-3p	CLIP-seq
MIRT1196066	hsa-miR-374a	CLIP-seq
MIRT1196067	hsa-miR-374b	CLIP-seq
MIRT2583429	hsa-miR-377	CLIP-seq
MIRT2583430	hsa-miR-3910	CLIP-seq
MIRT2583431	hsa-miR-3913-5p	CLIP-seq
MIRT2583432	hsa-miR-3919	CLIP-seq
MIRT1196068	hsa-miR-3925-3p	CLIP-seq
MIRT2583433	hsa-miR-3941	CLIP-seq
MIRT2583434	hsa-miR-4275	CLIP-seq
MIRT2583435	hsa-miR-4327	CLIP-seq
MIRT2583436	hsa-miR-4455	CLIP-seq
MIRT2583437	hsa-miR-466	CLIP-seq
MIRT2583438	hsa-miR-4660	CLIP-seq
MIRT2583439	hsa-miR-4668-5p	CLIP-seq
MIRT2583440	hsa-miR-4672	CLIP-seq
MIRT2583441	hsa-miR-4677-5p	CLIP-seq
MIRT2583442	hsa-miR-4711-5p	CLIP-seq
MIRT2583443	hsa-miR-4719	CLIP-seq
MIRT2583444	hsa-miR-4731-3p	CLIP-seq
MIRT2583445	hsa-miR-4756-3p	CLIP-seq
MIRT2583446	hsa-miR-4801	CLIP-seq
MIRT2583447	hsa-miR-5047	CLIP-seq
MIRT2583448	hsa-miR-548an	CLIP-seq
MIRT1196070	hsa-miR-568	CLIP-seq
MIRT2583449	hsa-miR-583	CLIP-seq
MIRT2583450	hsa-miR-618	CLIP-seq
MIRT1196071	hsa-miR-766	CLIP-seq
MIRT2686656	hsa-miR-3183	CLIP-seq
MIRT2686657	hsa-miR-339-5p	CLIP-seq
MIRT2686658	hsa-miR-4421	CLIP-seq
MIRT2686659	hsa-miR-4723-3p	CLIP-seq
MIRT2686660	hsa-miR-593	CLIP-seq
MIRT2686661	hsa-miR-642a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21982860, 25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	7891157
GO:0008038	Process	Neuron recognition	IEA
GO:0008038	Process	Neuron recognition	TAS	7891157
GO:0016020	Component	Membrane	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 607938
• HGNC: 17941
• e!Ensembl: ENSG00000182667

Protein

• UniProt ID: Q9P121
• Protein name: Neurotrimin (hNT) (IgLON family member 2)
• Protein function: Neural cell adhesion molecule.
• PDB: 6DLF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	36 → 132	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	135 → 205		Domain
  PF13927	Ig_3	222 → 299		Domain

• Sequence:

  MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
  NRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTD
  NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFV
  SEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGT
  LQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNK
  LGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF

• Sequence length: 344

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPERGER SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective tissue disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	23054244	Associate	★☆☆☆☆ Found in Text Mining only
Aphakia, congenital primary	Congenital primary aphakia	BEFREE	29190796		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27021288	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	27021288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	32807774	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26334118		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	27889361, 29981718		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23495067	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16115914	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29190796		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35991839	Associate	★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	23054244	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	24616287		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31664094		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31077618		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	23495067	Associate	★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	30485372		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	27889361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22661486	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22661486		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	23495067		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31664094		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30720061	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	23054244		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23054244, 34668355	Associate	★☆☆☆☆ Found in Text Mining only
Jacobsen Distal 11q Deletion Syndrome	Jacobsen Syndrome	BEFREE	26334118		★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	BEFREE	27889361		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	32033718	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29410287		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30104265, 31221809		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	28265761, 30032669, 31077618		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	26334118		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21036197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21036197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23495067		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	30485372		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	28252353		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31664094		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	GWASCAT_DG	27182965		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16115914, 29410287		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16115914	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	28252353		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31159865		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	27889361		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33934205	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28814981	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	21036197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21036197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations